DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and Tlr7

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_017457568.1 Gene:Tlr7 / 317468 RGDID:1563357 Length:1068 Species:Rattus norvegicus


Alignment Length:641 Identity:150/641 - (23%)
Similarity:245/641 - (38%) Gaps:189/641 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ALRQFMKLEILRITDSNLPAIGAESFWGLKYLRILDLSKNNIT-NITENNF-RGQDNLLELDLSK 139
            |.....:|::||:..::|..:.||.|..:..|:.||||:|.:. .|.|..| ....||::||||.
  Rat   303 AFDSLTELKVLRLHSNSLQHVPAEWFKNMSNLQELDLSQNYLAREIEEAKFLNSLPNLVQLDLSF 367

  Fly   140 NKVLRM--ASSTFRH----LTDLRRL--------NLADNSI------------------VELVQR 172
            |..|::  ||.|..|    ||.|:.|        .|.|:|:                  :::...
  Rat   368 NYELQVYHASITLPHSLSSLTKLKNLYIKGYVFKELKDSSLSVLHNLSNLEVLDLGTNFIKIADL 432

  Fly   173 NFF-MLSRLKYLDLSGNPLQ--------DLQPDVFRDV----PE-LKVLK-------CRNCQLKK 216
            |.| ....||::|||.|.:.        .|.|:....|    |: |:.|.       .|:|:.|.
  Rat   433 NIFQQFENLKFIDLSVNKISPSEESREVGLCPNAQTSVDWHGPQVLEALHYFRYDEYARSCRFKN 497

  Fly   217 INPQMYNLLPLLSE-------LDLGRNEFKFLDKDEFRDVKRLTKVLLDGNQLSVVVD-QLFRMQ 273
            ..|..:  |||.::       |||.||...|:...:|:.:..|..:.|.||.:...:: ...:..
  Rat   498 KEPPTF--LPLNADCHTYGKTLDLSRNNIFFIKPSDFKHLSFLKCLNLSGNAIGQTLNGSELQPL 560

  Fly   274 KSLNHLDLSYNRLAKVPNDSFLQLTNLTFLDLSYN-----------------KLVRLE------- 314
            :.|.:||.|.|||..:.:.:|.:|.||..||||.|                 ||..||       
  Rat   561 RELRYLDFSNNRLDLLYSTAFEELQNLEILDLSSNSHYFQAEGITHMLNFTKKLRHLEKLMMNDN 625

  Fly   315 ---PQSIRSL--SNLLTLNISGNVLMDL-----REMRETFEPLIYYFFLTCSK---------LFF 360
               ..:.|::  .:|..|...||.|..|     ....:.|:.|:....|..|:         :|.
  Rat   626 DISTSASRTMESESLRVLEFRGNHLDVLWRDGDNRYLDFFKNLLNLEELDISRNSLNSVPPGVFE 690

  Fly   361 QLIPQLTHLAIADMG--------------------------TMPVGLLHPFKQLRYLNISGNSLN 399
            .:.|.||.|::|..|                          |:|..|.:..|.|..|.::.|.:.
  Rat   691 GMPPNLTTLSLAKNGLRSFSWGRLQLLKHLKNLDLSHNQLTTVPARLANCSKSLTKLILNHNQIR 755

  Fly   400 NTALEVIDPCRELEFLDLSRNQLHGISE----DTVLRIQGIRNVRLDNNPLICDECHMGKLINVV 460
            ......::...:|.:||:|.|::..|.:    :.||  ..:..:.|.:|..:|: |.....:   
  Rat   756 QLTKYFLEDALQLRYLDISSNKIQVIQKTSFPENVL--NNLNMLLLHHNRFLCN-CDAVWFV--- 814

  Fly   461 RQLQWKW-----DTYP------ICFLPKSLRGAEINNLDINGLHTCLTFITDEEQNAASTSYNFL 514
                | |     .|.|      .|..|.:.:|..:.:||   |:||...:|:....:.|.|    
  Rat   815 ----W-WVNHTDVTIPYLATDVTCAGPGAHKGQSVISLD---LYTCELDLTNLILFSVSIS---- 867

  Fly   515 EHGGLNTLAILGGIIFVLIAVIILSL-------VACFSKNRARYYTREDHLNGSES 563
                        .::|::|.:....|       :..|.|.:.:.|   .||...||
  Rat   868 ------------SVLFLMIVMTTSHLFFWDMWYIYYFWKAKIKGY---QHLQSMES 908

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 9/24 (38%)
LRR_8 131..190 CDD:290566 27/91 (30%)
leucine-rich repeat 132..155 CDD:275380 12/28 (43%)
LRR_RI 151..422 CDD:238064 90/398 (23%)
leucine-rich repeat 156..179 CDD:275380 7/49 (14%)
LRR_8 178..262 CDD:290566 30/110 (27%)
leucine-rich repeat 180..203 CDD:275380 9/34 (26%)
leucine-rich repeat 204..251 CDD:275380 16/60 (27%)
leucine-rich repeat 252..275 CDD:275380 4/23 (17%)
LRR_8 274..334 CDD:290566 25/88 (28%)
leucine-rich repeat 276..299 CDD:275380 9/22 (41%)
LRR_4 298..342 CDD:289563 18/77 (23%)
leucine-rich repeat 300..323 CDD:275380 11/51 (22%)
leucine-rich repeat 388..411 CDD:275380 3/22 (14%)
Tlr7XP_017457568.1 leucine-rich repeat 66..87 CDD:275380
LRR_8 93..157 CDD:290566
leucine-rich repeat 109..146 CDD:275380
leucine-rich repeat 147..191 CDD:275380
leucine-rich repeat 192..223 CDD:275380
LRR_8 222..277 CDD:290566
LRR_RI 223..472 CDD:238064 47/168 (28%)
leucine-rich repeat 224..244 CDD:275380
leucine-rich repeat 245..268 CDD:275380
leucine-rich repeat 269..309 CDD:275380 1/5 (20%)
LRR_8 308..368 CDD:290566 22/59 (37%)
leucine-rich repeat 310..333 CDD:275380 7/22 (32%)
leucine-rich repeat 334..359 CDD:275380 9/24 (38%)
leucine-rich repeat 370..389 CDD:275380 6/18 (33%)
leucine-rich repeat 390..416 CDD:275380 5/25 (20%)
leucine-rich repeat 417..440 CDD:275380 2/22 (9%)
LRR_8 515..573 CDD:290566 16/57 (28%)
leucine-rich repeat 515..537 CDD:275380 7/21 (33%)
LRR_RI 532..778 CDD:238064 55/245 (22%)
leucine-rich repeat 538..562 CDD:275380 4/23 (17%)
LRR_8 561..627 CDD:290566 20/65 (31%)
leucine-rich repeat 563..586 CDD:275380 9/22 (41%)
leucine-rich repeat 587..616 CDD:275380 8/28 (29%)
leucine-rich repeat 617..639 CDD:275380 3/21 (14%)
LRR_8 639..706 CDD:290566 16/66 (24%)
leucine-rich repeat 640..670 CDD:275380 8/29 (28%)
leucine-rich repeat 671..695 CDD:275380 3/23 (13%)
LRR_8 694..754 CDD:290566 13/59 (22%)
leucine-rich repeat 696..719 CDD:275380 5/22 (23%)
leucine-rich repeat 720..743 CDD:275380 3/22 (14%)
leucine-rich repeat 768..786 CDD:275380 6/17 (35%)
TIR 909..1054 CDD:214587 150/641 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.