DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and hfw

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_001259135.1 Gene:hfw / 31120 FlyBaseID:FBgn0001189 Length:611 Species:Drosophila melanogaster


Alignment Length:477 Identity:101/477 - (21%)
Similarity:179/477 - (37%) Gaps:136/477 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SKNNI---TNITENNFRGQDNLLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFF 175
            |.:||   ||:...|...:|    :||| |.:.|          .|:.|.:.|.:|..||.. |.
  Fly   207 SCSNISKWTNLHVRNMTVED----MDLS-NPIFR----------SLQSLAVTDGNITRLVNA-FP 255

  Fly   176 MLSRLKYLDLSGNPLQDLQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKF 240
            .||.||.|::|.|.:.::.....:|||.|:.....|..|        :|:|       .||:.|.
  Fly   256 RLSALKCLNISNNNISEIHSRAVKDVPHLEFFGMSNNNL--------SLVP-------HRNQNKN 305

  Fly   241 LDKDEFRDVKRLTKVLLDGN--QLSVVVDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQ--LTNLT 301
            :..|            :.||  .|...::::. ..:|:|.|:         |..|:.|  .|:..
  Fly   306 ITLD------------ISGNMRMLCTPLNEII-YTESINFLN---------PKHSYCQYNATHTW 348

  Fly   302 FLDLSYNKLVRLEPQSIRSLSNLLTL------NISGNVLMDLREMRETFEPLIYYFFLTCSKLFF 360
            |.......:.:||.:. |.::|...:      |.:...:|.:::.:.  :|..:   :.||.|..
  Fly   349 FQSTDKVSVEQLENRK-RCVTNCPVIPNYGSCNCTLENIMIIQDNQS--KPQCH---VDCSNLGL 407

  Fly   361 QLIPQ----------LTHLAIADMG----TMPVGLLHPFKQLRYLNISGNSLNNTALEVIDPCRE 411
            ..:||          :|:..|..:|    |.|.          |.||:....:|..:..|.....
  Fly   408 VELPQRLPDNTFMLNITNNKITSLGDYFHTNPT----------YHNINRLLADNNQISSIYEFEG 462

  Fly   412 LEFLD------LSRNQLHGISE---DTVLRIQGI-RNVRLDNNPLICDECHMGKLINVVRQLQWK 466
            .:|::      :..|.|..|.|   :..|...|: |.:.|..|.|.|| |:..|.:.     .|.
  Fly   463 TKFIETFQRIYMRNNSLSKIPEYFLNNALMDSGLGRRIYLAGNKLQCD-CNSAKTLQ-----NWL 521

  Fly   467 WDTYPICFLPKSLRGAEI-NNLDINGLHTCLTFITDEEQNAASTSYNFLEHGGLNTLAILGGIIF 530
            .:           |.::| :.::|...:.....|..:|.....:..::.::            |:
  Fly   522 KE-----------RSSDIPDYMEIRCRNMPQRVIELQEAKLCQSPPDWTDY------------IY 563

  Fly   531 VLIAVIILSLVACFSKNRARYY 552
            .|||..:|.|:|..:|....|:
  Fly   564 YLIAAEVLLLLALITKVSYDYW 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380 6/19 (32%)
LRR_8 131..190 CDD:290566 19/58 (33%)
leucine-rich repeat 132..155 CDD:275380 5/22 (23%)
LRR_RI 151..422 CDD:238064 61/300 (20%)
leucine-rich repeat 156..179 CDD:275380 8/22 (36%)
LRR_8 178..262 CDD:290566 20/85 (24%)
leucine-rich repeat 180..203 CDD:275380 7/22 (32%)
leucine-rich repeat 204..251 CDD:275380 9/46 (20%)
leucine-rich repeat 252..275 CDD:275380 3/24 (13%)
LRR_8 274..334 CDD:290566 13/67 (19%)
leucine-rich repeat 276..299 CDD:275380 5/24 (21%)
LRR_4 298..342 CDD:289563 8/49 (16%)
leucine-rich repeat 300..323 CDD:275380 4/22 (18%)
leucine-rich repeat 388..411 CDD:275380 5/22 (23%)
hfwNP_001259135.1 LRR_8 235..294 CDD:290566 20/69 (29%)
leucine-rich repeat 237..259 CDD:275378 8/22 (36%)
leucine-rich repeat 260..283 CDD:275378 7/22 (32%)
leucine-rich repeat 284..304 CDD:275378 7/34 (21%)
leucine-rich repeat 420..443 CDD:275378 6/32 (19%)
leucine-rich repeat 444..465 CDD:275378 3/20 (15%)
leucine-rich repeat 466..497 CDD:275378 6/30 (20%)
leucine-rich repeat 498..509 CDD:275378 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.