DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and Nepn

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_006256553.1 Gene:Nepn / 309775 RGDID:1307755 Length:512 Species:Rattus norvegicus


Alignment Length:489 Identity:126/489 - (25%)
Similarity:202/489 - (41%) Gaps:103/489 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFKWLLFSLCIMPAMFSNTKRKCPTECQC-SMDDLDRYQAICTKGGLNSLLSPNELDVDVKVII 64
            :|:.:||: |.:...:.:|    ||..|.| |:..:..|:.:....|:.|               
  Rat     3 LLWAFLLW-LSLSNVLGAN----CPGRCSCDSLQSVQCYRLLEVPSGIPS--------------- 47

  Fly    65 IRGPRNSITIGPALRQFMKL----EILRITDSNLPAIGAESFWGLKYLRILDLSKNNITNITENN 125
               ....:.|..:..|.::|    ::|.:.|..|.|.|.||                   |..:.
  Rat    48 ---TTRRLYISHSRIQHLQLSNLTQLLALEDFILLASGTES-------------------IENDT 90

  Fly   126 FRGQDNLLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPL 190
            |:....|..|:|.|||:.|:.|:.   ..:|..|.|.||||..|...:|..||.||.|:|..|.:
  Rat    91 FKTLTTLKTLELWKNKLRRVPSAL---PANLEVLKLNDNSICALHGSDFEGLSNLKVLELKNNLI 152

  Fly   191 QDLQPDVFR----------------------DVPELKVLKCRNCQLKKINPQMYNLLPLLSELDL 233
            ..|.|.:..                      .:|.||.:.....:|..|:..::..|..|..|..
  Rat   153 SSLSPSMLSSLVSLQSLLVDGNNIESVTGPLSLPNLKYMSMEKNKLHLISGNVFTSLQNLQFLSF 217

  Fly   234 GRNEFKFLDKDEFRDVKRLTKVLLDGNQLSVVVDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLT 298
            ..|   ||.|......|.|..:.::.|||.||..:..|..::|:||.||.|.|:.:  |....||
  Rat   218 SGN---FLTKIPINLPKSLLSLKMERNQLKVVRFRDMRHLENLSHLYLSENLLSSI--DGAQLLT 277

  Fly   299 NLTFLDLSYNKLVRLEPQSIRSLSNLLTLNISGNVL--------MDLREMRETFEPLIYYFFL-- 353
            |||.|:.|.|:|..|.|   |..|.|..|:.|.|.:        .|||:::        :.||  
  Rat   278 NLTTLEASQNRLQMLPP---RLPSRLQKLDCSSNFIQRVTAPEFQDLRDLK--------HLFLDN 331

  Fly   354 TCSKLF----FQLIPQLTHLAIADMGTMPVGLLHPFKQLRYLNISGNSLNNTALEVIDPCRELEF 414
            ....||    .|...||::||:.....:.:.|..| |.|..|::.||::.:.|...:...::|:.
  Rat   332 NVVSLFEAGALQKCSQLSNLALEQNLLLSIPLRLP-KTLARLDLKGNAIQDMAERELRDLKQLQV 395

  Fly   415 LDLSRNQLHGISEDTVLRIQGIRNVRLDNNPLIC 448
            |:|..|::..:....:..:..:|::.||.||..|
  Rat   396 LNLRNNKISALDLKALEGLPRLRHLYLDGNPWNC 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 8/26 (31%)
leucine-rich repeat 108..131 CDD:275380 2/22 (9%)
LRR_8 131..190 CDD:290566 24/58 (41%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
LRR_RI 151..422 CDD:238064 87/306 (28%)
leucine-rich repeat 156..179 CDD:275380 10/22 (45%)
LRR_8 178..262 CDD:290566 23/105 (22%)
leucine-rich repeat 180..203 CDD:275380 7/44 (16%)
leucine-rich repeat 204..251 CDD:275380 11/46 (24%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
LRR_8 274..334 CDD:290566 25/59 (42%)
leucine-rich repeat 276..299 CDD:275380 9/22 (41%)
LRR_4 298..342 CDD:289563 19/51 (37%)
leucine-rich repeat 300..323 CDD:275380 9/22 (41%)
leucine-rich repeat 388..411 CDD:275380 5/22 (23%)
NepnXP_006256553.1 leucine-rich repeat 50..72 CDD:275380 3/21 (14%)
leucine-rich repeat 73..96 CDD:275380 8/41 (20%)
leucine-rich repeat 118..141 CDD:275380 10/22 (45%)
leucine-rich repeat 142..165 CDD:275380 7/22 (32%)
leucine-rich repeat 166..187 CDD:275380 0/20 (0%)
leucine-rich repeat 188..211 CDD:275380 5/22 (23%)
leucine-rich repeat 212..235 CDD:275380 8/25 (32%)
leucine-rich repeat 236..256 CDD:275380 6/19 (32%)
LRR_RI <251..425 CDD:238064 53/187 (28%)
leucine-rich repeat 257..278 CDD:275380 9/22 (41%)
leucine-rich repeat 279..299 CDD:275380 9/22 (41%)
LRR_8 298..358 CDD:290566 17/67 (25%)
leucine-rich repeat 300..323 CDD:275380 6/22 (27%)
leucine-rich repeat 324..347 CDD:275380 5/30 (17%)
leucine-rich repeat 348..371 CDD:275380 7/23 (30%)
LRR_8 367..426 CDD:290566 13/58 (22%)
leucine-rich repeat 372..392 CDD:275380 4/19 (21%)
leucine-rich repeat 393..416 CDD:275380 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243556at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.