DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and Islr

DIOPT Version :10

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:XP_006511267.1 Gene:Islr / 26968 MGIID:1349645 Length:436 Species:Mus musculus


Alignment Length:458 Identity:94/458 - (20%)
Similarity:149/458 - (32%) Gaps:156/458 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLCIMP-AMFSNTKRKCPTECQCSMDDLDRYQAICTKGGLNSLLSPNELDVDVKVIIIRGPRNSI 72
            :||::. |:..|..|.||..|.|                                          
Mouse    11 ALCLLCWAVLLNLVRACPEPCDC------------------------------------------ 33

  Fly    73 TIGPALRQFMKLEILRITDSNLPAIGAESFWGLKY-LRILDLSKNNITNITENNFRGQDNLLELD 136
                                           |.|| .:|.|.:..::..:.. .|..  |:..|.
Mouse    34 -------------------------------GEKYGFQIADCAYRDLEGVPP-GFPA--NVTTLS 64

  Fly   137 LSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRLKYLDLSGNPLQDLQPDVFRDV 201
            ||.|::..:....||.:..|:.|.||.|.|..:.......||.||.||||.|.|.:.......::
Mouse    65 LSANRLPGLPEGAFREVPLLQSLWLAHNEIRSVAIGALAPLSHLKSLDLSHNLLSEFAWSDLHNL 129

  Fly   202 PELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKFLDKDEFRDVKRLTKVLLDGNQLSVVV 266
            ..|::||                        :..||..|:.:|.|..:..|..:.|:.|:|..:.
Mouse   130 SALQLLK------------------------MDSNELAFIPRDAFSSLSALRSLQLNHNRLHALA 170

  Fly   267 DQLFRMQKSLNHLDLSYN-----------------RLAKVPNDSFLQLTNLTFLDLSYNKLVRLE 314
            :..|....:|:||.::.|                 ....:|....:..|  |...|....|.||.
Mouse   171 EGTFAPLTALSHLQINDNPFDCTCGIVWFKTWALASAVSIPEQDNIACT--TPHVLKGIPLGRLP 233

  Fly   315 PQSIRSLSNLLTLNISGNVLMDLREMRETFEPLIYYFFLTCSKLFFQLIPQL----------THL 369
            |....:.|    :.:|.....|..|:|..|     ...|.|. :..|.:|||          ..:
Mouse   234 PLPCSAPS----VQLSYQPSQDGAELRPGF-----VLALHCD-VDGQPVPQLHWHIHTPGGTVEI 288

  Fly   370 AIADMGT----MPVGLLHPFKQLRYLNISGNSLNNTALEVIDPCRELE---FLDLSRNQLHGISE 427
            |..::||    :| |.|....|.|:...:..||      :|....:||   :..|:.|:| |.:|
Mouse   289 ASPNVGTDGRALP-GALATSGQPRFQAFANGSL------LIPDFGKLEEGTYSCLATNEL-GSAE 345

  Fly   428 DTV 430
            .:|
Mouse   346 SSV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 LRR 69..>446 CDD:443914 85/397 (21%)
leucine-rich repeat 84..107 CDD:275380 1/22 (5%)
leucine-rich repeat 108..131 CDD:275380 3/22 (14%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..203 CDD:275380 8/22 (36%)
leucine-rich repeat 204..251 CDD:275380 8/46 (17%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
leucine-rich repeat 276..299 CDD:275380 5/39 (13%)
leucine-rich repeat 300..323 CDD:275380 6/22 (27%)
leucine-rich repeat 388..411 CDD:275380 4/22 (18%)
IslrXP_006511267.1 leucine-rich repeat 40..59 CDD:275380 3/21 (14%)
LRR <59..>190 CDD:443914 40/154 (26%)
leucine-rich repeat 60..83 CDD:275380 6/22 (27%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 8/22 (36%)
leucine-rich repeat 132..155 CDD:275380 8/46 (17%)
leucine-rich repeat 156..179 CDD:275380 5/22 (23%)
PCC 161..>235 CDD:188093 15/75 (20%)
Ig 247..351 CDD:472250 29/116 (25%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 2/3 (67%)
Ig strand E 318..322 CDD:409353 2/9 (22%)
Ig strand F 332..337 CDD:409353 0/4 (0%)
Ig strand G 345..348 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.