DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and Tlr7

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_001277687.1 Gene:Tlr7 / 170743 MGIID:2176882 Length:1053 Species:Mus musculus


Alignment Length:726 Identity:164/726 - (22%)
Similarity:268/726 - (36%) Gaps:230/726 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NTKRKCPTECQCSMDDLDRYQAICTKGGLNSLLSPNELDVDVKVIIIRG--PR------------ 69
            |.....||....::.:|..|..|..|...|...:.|||    :|:.:.|  ||            
Mouse   217 NNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNEL----QVLDLSGNCPRCYNVPYPCTPCE 277

  Fly    70 ------------NSITIGPALRQFMKLEILRITDSNLPAIGAESFWGLKYLRILDLSKNNIT-NI 121
                        ||:|         :|::||:..::|..:....|..::.|:.||||:|.:. .|
Mouse   278 NNSPLQIHDNAFNSLT---------ELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREI 333

  Fly   122 TENNF-RGQDNLLELDLSKN----------------------KVLRMASSTFRHLTD-------- 155
            .|..| ....||:|||.|.|                      |:||:....|:.|.:        
Mouse   334 EEAKFLHFLPNLVELDFSFNYELQVYHASITLPHSLSSLENLKILRVKGYVFKELKNSSLSVLHK 398

  Fly   156 LRRLNLAD--NSIVELVQRNFFM-LSRLKYLDLSGNPLQ------------DLQPDVFRDVPE-L 204
            |.||.:.|  .:.:::...|.|. ...||.:|||.|.:.            :.|..|.|..|: |
Mouse   399 LPRLEVLDLGTNFIKIADLNIFKHFENLKLIDLSVNKISPSEESREVGFCPNAQTSVDRHGPQVL 463

  Fly   205 KVLK-------CRNCQLKKINPQMYNLLPLLSE-------LDLGRNEFKFLDKDEFRDVKRLTKV 255
            :.|.       .|:|:.|...|..:  |||.::       |||.||...|:...:|:.:..|..:
Mouse   464 EALHYFRYDEYARSCRFKNKEPPSF--LPLNADCHIYGQTLDLSRNNIFFIKPSDFQHLSFLKCL 526

  Fly   256 LLDGNQLSVVVD--QLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNLTFLDLSYN---------- 308
            .|.||.:...::  :|:.: :.|.:||.|.|||..:.:.:|.:|.:|..||||.|          
Mouse   527 NLSGNTIGQTLNGSELWPL-RELRYLDFSNNRLDLLYSTAFEELQSLEVLDLSSNSHYFQAEGIT 590

  Fly   309 ------KLVRL-------------------EPQSIR-------------------------SLSN 323
                  |.:||                   |..|:|                         :|.|
Mouse   591 HMLNFTKKLRLLDKLMMNDNDISTSASRTMESDSLRILEFRGNHLDVLWRAGDNRYLDFFKNLFN 655

  Fly   324 LLTLNISGNVLMDL-REMRETFEPLIYYFFLTCSKL---FFQLIPQLTHLAIADMG-----TMPV 379
            |..|:||.|.|..| .|:.|...|.:....|..:.|   |:..:..|.||.|.|:.     .:|.
Mouse   656 LEVLDISRNSLNSLPPEVFEGMPPNLKNLSLAKNGLKSFFWDRLQLLKHLEILDLSHNQLTKVPE 720

  Fly   380 GLLHPFKQLRYLNISGNSLNNTALEVIDPCRELEFLDLSRNQLHGISE----DTVLRIQGIRNVR 440
            .|.:..|.|..|.:..|.:.......::...:|.:||:|.|::..|.:    :.||  ..:..:.
Mouse   721 RLANCSKSLTTLILKHNQIRQLTKYFLEDALQLRYLDISSNKIQVIQKTSFPENVL--NNLEMLV 783

  Fly   441 LDNNPLICDECHMGKLINVVRQLQWKW-----DTYP------ICFLPKSLRGAEINNLDINGLHT 494
            |.:|..:|: |.....:       | |     .|.|      .|..|.:.:|..:.:||   |:|
Mouse   784 LHHNRFLCN-CDAVWFV-------W-WVNHTDVTIPYLATDVTCVGPGAHKGQSVISLD---LYT 836

  Fly   495 CLTFITDEEQNAASTSYNFLEHGGLNTLAILGGIIFVLIAVIILSL-------VACFSKNRARYY 552
            |...:|:....:.|.|                .::|:::.:....|       :..|.|.:.:.|
Mouse   837 CELDLTNLILFSVSIS----------------SVLFLMVVMTTSHLFFWDMWYIYYFWKAKIKGY 885

  Fly   553 TREDHLNGSES 563
               .||...||
Mouse   886 ---QHLQSMES 893

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..131 CDD:275380 9/24 (38%)
LRR_8 131..190 CDD:290566 24/91 (26%)
leucine-rich repeat 132..155 CDD:275380 11/44 (25%)
LRR_RI 151..422 CDD:238064 90/379 (24%)
leucine-rich repeat 156..179 CDD:275380 6/25 (24%)
LRR_8 178..262 CDD:290566 30/110 (27%)
leucine-rich repeat 180..203 CDD:275380 9/34 (26%)
leucine-rich repeat 204..251 CDD:275380 16/60 (27%)
leucine-rich repeat 252..275 CDD:275380 5/24 (21%)
LRR_8 274..334 CDD:290566 28/119 (24%)
leucine-rich repeat 276..299 CDD:275380 9/22 (41%)
LRR_4 298..342 CDD:289563 22/104 (21%)
leucine-rich repeat 300..323 CDD:275380 13/82 (16%)
leucine-rich repeat 388..411 CDD:275380 3/22 (14%)
Tlr7NP_001277687.1 PRK15370 <35..>246 CDD:185268 7/28 (25%)
leucine-rich repeat 51..72 CDD:275380
leucine-rich repeat 73..93 CDD:275380
leucine-rich repeat 94..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380
PLN00113 177..>789 CDD:215061 138/589 (23%)
leucine-rich repeat 177..208 CDD:275380
leucine-rich repeat 209..229 CDD:275380 3/11 (27%)
leucine-rich repeat 230..253 CDD:275380 5/22 (23%)
leucine-rich repeat 254..294 CDD:275380 8/52 (15%)
leucine-rich repeat 295..318 CDD:275380 5/22 (23%)
leucine-rich repeat 319..344 CDD:275380 9/24 (38%)
leucine-rich repeat 345..401 CDD:275380 12/55 (22%)
leucine-rich repeat 402..425 CDD:275380 4/22 (18%)
leucine-rich repeat 500..522 CDD:275380 7/21 (33%)
leucine-rich repeat 523..547 CDD:275380 5/24 (21%)
leucine-rich repeat 548..571 CDD:275380 9/22 (41%)
leucine-rich repeat 572..601 CDD:275380 7/28 (25%)
leucine-rich repeat 602..624 CDD:275380 1/21 (5%)
leucine-rich repeat 625..655 CDD:275380 2/29 (7%)
leucine-rich repeat 656..680 CDD:275380 9/23 (39%)
leucine-rich repeat 681..704 CDD:275380 4/22 (18%)
leucine-rich repeat 705..728 CDD:275380 5/22 (23%)
leucine-rich repeat 753..778 CDD:275380 8/26 (31%)
PCC 757..>841 CDD:188093 22/97 (23%)
TIR 894..1039 CDD:214587 164/726 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.