DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and TLR6

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_001381482.1 Gene:TLR6 / 10333 HGNCID:16711 Length:796 Species:Homo sapiens


Alignment Length:683 Identity:131/683 - (19%)
Similarity:244/683 - (35%) Gaps:232/683 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VIIIRGPR------NSITIGPALRQF--------MKLEILRITDSNLPAIGAESFWGLKYLRILD 112
            :|||.|.|      |...:..:.|..        :|.::|.::.:.:..:.......|..|.:|.
Human    18 MIIIVGTRIQFSDGNEFAVDKSKRGLIHVPKDLPLKTKVLDMSQNYIAELQVSDMSFLSELTVLR 82

  Fly   113 LSKNNITNITENNFRGQDNLLELDLSKNKVLRMASS---TFRHLTDLRRLNLADNSIVEL-VQRN 173
            ||.|.|..:..:.|:...:|..||||.|::.:::..   :|||      |:|:.|....| :.:.
Human    83 LSHNRIQLLDLSVFKFNQDLEYLDLSHNQLQKISCHPIVSFRH------LDLSFNDFKALPICKE 141

  Fly   174 FFMLSRLKYLDLSGNPLQ--DLQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLS------- 229
            |..||:|.:|.||...||  ||.|.....:..: :|..||..:|:...:...:|...:       
Human   142 FGNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYI-LLDLRNYYIKENETESLQILNAKTLHLVFHP 205

  Fly   230 ------ELDLGRNEFKFLDKDEFRDVKRLTKVLLDGNQLSVVVDQLFRMQK-------SLNHLDL 281
                  ::::..|....|         :||.:.|:.:...|.:..|..:.:       :|||::.
Human   206 TSLFAIQVNISVNTLGCL---------QLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIET 261

  Fly   282 SYNRLAKV-----PND-SFLQLTNLTFL------DLSYNKLVRLEPQSIRSLSN----------- 323
            ::..|.:|     |.. .:|.:.|||.:      |.:|:| ..|:..:|..::|           
Human   262 TWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSK-TTLKALTIEHITNQVFLFSQTALY 325

  Fly   324 ---------LLTLNISGNVLMDLREMRETFEPLIY-------YFFLTCSKLFFQLIPQLTHLAIA 372
                     :||::.:..:.|.......||:.|.:       ..|..||.|.     :|..|.:.
Human   326 TVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFEKCSTLV-----KLETLILQ 385

  Fly   373 DMG---TMPVGLL---------------------HP-----FKQLRYLNISGNSLNNTALEVIDP 408
            ..|   ...|||:                     |.     .:.:..||:|.|.|.::....:.|
Human   386 KNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTDSVFRCLPP 450

  Fly   409 CRELEFLDLSRNQLHGI---------------------------------------------SED 428
              .::.|||..|::..:                                             |.|
Human   451 --RIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSAD 513

  Fly   429 TVLRIQGIRNVRLDNNPLICDECHMGKLINVVRQLQ------WKWDTYPICFLPKSLRGAEINNL 487
            .....|.:|:::..:||..| .|.:.:.:..:.|:.      |. |:|. |..|:|.||:.:.:.
Human   514 FFQSCQKMRSIKAGDNPFQC-TCELREFVKNIDQVSSEVLEGWP-DSYK-CDYPESYRGSPLKDF 575

  Fly   488 DINGLHTCLTFITDEEQNAASTSYNFLEHGGLNTLAILGGIIFVLIAVIILSL-----------V 541
            .::.|...:|.:                      :..:|..:.|| ||.:.||           :
Human   576 HMSELSCNITLL----------------------IVTIGATMLVL-AVTVTSLCIYLDLPWYLRM 617

  Fly   542 AC---FSKNRARYYTREDHLNGSESKCLEKNLE 571
            .|   .::.|||....|:         |::||:
Human   618 VCQWTQTRRRARNIPLEE---------LQRNLQ 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380 2/22 (9%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
LRR_8 131..190 CDD:290566 20/62 (32%)
leucine-rich repeat 132..155 CDD:275380 9/25 (36%)
LRR_RI 151..422 CDD:238064 73/361 (20%)
leucine-rich repeat 156..179 CDD:275380 6/23 (26%)
LRR_8 178..262 CDD:290566 20/98 (20%)
leucine-rich repeat 180..203 CDD:275380 9/24 (38%)
leucine-rich repeat 204..251 CDD:275380 7/59 (12%)
leucine-rich repeat 252..275 CDD:275380 5/29 (17%)
LRR_8 274..334 CDD:290566 18/98 (18%)
leucine-rich repeat 276..299 CDD:275380 7/28 (25%)
LRR_4 298..342 CDD:289563 12/69 (17%)
leucine-rich repeat 300..323 CDD:275380 7/28 (25%)
leucine-rich repeat 388..411 CDD:275380 6/22 (27%)
TLR6NP_001381482.1 LRR 1 54..77 2/22 (9%)
LRR 2 78..101 7/22 (32%)
LRR 3 102..122 6/19 (32%)
LRR 4 123..147 9/29 (31%)
LRR 5 148..168 9/19 (47%)
LRR 6 169..196 5/27 (19%)
LRR 7 197..219 0/21 (0%)
LRR 8 220..250 6/38 (16%)
LRR 9 251..277 6/25 (24%)
LRR 10 278..303 7/25 (28%)
LRR 11 304..330 3/25 (12%)
LRR 12 331..354 3/22 (14%)
LRR 13 355..378 6/27 (22%)
LRR 14 379..404 6/24 (25%)
LRR 15 405..429 1/23 (4%)
LRR 16 430..450 5/19 (26%)
LRR 17 451..474 4/22 (18%)
LRR 18 475..496 0/20 (0%)
LRR 19 497..520 2/22 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.