DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdo and waif2

DIOPT Version :9

Sequence 1:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster
Sequence 2:NP_001245160.1 Gene:waif2 / 100884149 ZFINID:ZDB-GENE-120209-3 Length:313 Species:Danio rerio


Alignment Length:355 Identity:76/355 - (21%)
Similarity:127/355 - (35%) Gaps:117/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DKDEFR---DVKRLTKVL-LDGNQLSVVVDQLFRMQ----KSLNHLDLSYNRLAKVPNDSFLQLT 298
            |.||.:   :|.|.|::| |:...:||::::.|...    .||:.|.|..|.:..:.:.:|..|.
Zfish    27 DSDEIKLPLEVPRRTQILTLNNVNMSVLIERAFSANGTNAHSLHELSLRDNNIQVIQSCAFCGLH 91

  Fly   299 NLTFLDLSYNKLVRLEPQSIRSLSNLLTLNISGNVLMDLREMRETFEPLIYYFFLTCSKLFFQLI 363
            .|..||||.|:|..:.|::...|:.|..||:|                  |......:......:
Zfish    92 RLHLLDLSRNRLEDVHPEAFSELNQLRNLNLS------------------YTLTAAGANQLSSAL 138

  Fly   364 PQLTHLAIADMG-----TMPVGLLHPFKQLRYLNISGNSLNNTALEVIDPCRELEFLDLSRNQLH 423
            ..|::|.|.|:.     |:|:.....| .|..||::.||:..                |..|:|.
Zfish   139 DSLSNLQILDLSGNRLKTIPLSGFGKF-SLTMLNLTHNSITT----------------LDTNELT 186

  Fly   424 GISEDTVLRIQGIRNVRLDNNPLIC---------------DECHMGKLINVVRQLQWKWDTYPIC 473
            .:||...:|      |.|.:||..|               .:|...|.:.              |
Zfish   187 KLSEYREMR------VYLSHNPFDCRCDRLREFHDWLKNSSQCADSKNLR--------------C 231

  Fly   474 FLPKSLRGAEINNLDINGLHTCLTFITDEEQNAASTSYNFLEHGGLNTLAILGGIIFVLIAVIIL 538
            .|||..:...:.::|      |        :|..|              .:|.||:..||.|:.|
Zfish   232 ALPKVQKDLRVESVD------C--------KNVGS--------------FVLLGIVLALIGVVFL 268

  Fly   539 SLVACFSKNRARYYTREDHLNGSESKCLEK 568
            .::....:...|:      ||.....|.::
Zfish   269 MVLYLNRRGIKRW------LNNIREACRDQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdoNP_001286024.1 leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
LRR_8 131..190 CDD:290566
leucine-rich repeat 132..155 CDD:275380
LRR_RI 151..422 CDD:238064 46/192 (24%)
leucine-rich repeat 156..179 CDD:275380
LRR_8 178..262 CDD:290566 8/23 (35%)
leucine-rich repeat 180..203 CDD:275380
leucine-rich repeat 204..251 CDD:275380 4/11 (36%)
leucine-rich repeat 252..275 CDD:275380 6/27 (22%)
LRR_8 274..334 CDD:290566 20/59 (34%)
leucine-rich repeat 276..299 CDD:275380 6/22 (27%)
LRR_4 298..342 CDD:289563 13/43 (30%)
leucine-rich repeat 300..323 CDD:275380 9/22 (41%)
leucine-rich repeat 388..411 CDD:275380 5/22 (23%)
waif2NP_001245160.1 LRRNT 11..42 CDD:214470 5/14 (36%)
leucine-rich repeat 42..68 CDD:275380 5/25 (20%)
LRR_RI <68..156 CDD:238064 25/105 (24%)
LRR_8 68..126 CDD:290566 21/75 (28%)
leucine-rich repeat 69..92 CDD:275380 6/22 (27%)
leucine-rich repeat 93..116 CDD:275380 9/22 (41%)
leucine-rich repeat 117..143 CDD:275380 6/43 (14%)
LRR_8 142..203 CDD:290566 20/83 (24%)
LRR_4 143..182 CDD:289563 12/55 (22%)
leucine-rich repeat 144..166 CDD:275380 6/22 (27%)
leucine-rich repeat 167..190 CDD:275380 8/38 (21%)
TPKR_C2 201..246 CDD:301599 9/58 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.