DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and AT5G48655

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001318762.1 Gene:AT5G48655 / 834923 AraportID:AT5G48655 Length:203 Species:Arabidopsis thaliana


Alignment Length:154 Identity:44/154 - (28%)
Similarity:66/154 - (42%) Gaps:40/154 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SDSSSSSRSIDRTPFLLEYSSDSES--------------SSSSDSESSSTSISFDSSMSSTESST 142
            :::.|.||:..|.|.:::..|...:              ||.|..:....|::.:.:|||     
plant    70 AEAKSKSRNARRRPLMVDVESGGTTRFPANISNKRRRIPSSESVIDCEHASVNDEVNMSS----- 129

  Fly   143 PMGHTESSDSNEDSPPNKRIKSDDEESKKSVLPYNCPVCLEDVREKLPVSTNCGHVFCKACIKRA 207
                 ..|.|...:||       .||.|     :.||:|:....|::  ||.|||:|||.|||.|
plant   130 -----RVSRSKAPAPP-------PEEPK-----FTCPICMCPFTEEM--STKCGHIFCKGCIKMA 175

  Fly   208 VDTGRVCPLC--GVDEPEFHRIFL 229
            :.....||.|  .|...|..|:||
plant   176 ISRQGKCPTCRKKVTAKELIRVFL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 18/38 (47%)
AT5G48655NP_001318762.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4259
eggNOG 1 0.900 - - E1_KOG0320
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2572
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431236at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 1 1.000 - - mtm1215
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.