DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and AT3G07200

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001078119.1 Gene:AT3G07200 / 819908 AraportID:AT3G07200 Length:182 Species:Arabidopsis thaliana


Alignment Length:179 Identity:49/179 - (27%)
Similarity:81/179 - (45%) Gaps:27/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SGLRSRLLSGSSERNPNEYYGD---SDSSSSSRSIDRTP-----FLLEYSSD---SESSSSSDSE 123
            :.:|.|...|.::   ||:.||   :|.:.:...|..||     ..:|...|   |.:|:.:.::
plant     8 TSMRLRRRDGVTQ---NEHQGDQQVADQAPTVPQIVATPPRINVVAIEDDDDVVESTASAFAQAK 69

  Fly   124 SSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPPNKRIKSDDEESKKSVLP------YNCPVCL 182
            :.|.|....|.:...||:   |...|:....|......::.:.....|:|.|      ::||:||
plant    70 NKSRSARRGSQVVDVESA---GANRSTRRRSDQTSVDSVELNKPRKSKAVAPPVEEPKFSCPICL 131

  Fly   183 EDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLC--GVDEPEFHRIFL 229
            ....::  |||.|||:|||.|||.|:.....||.|  .:...:..|:||
plant   132 CPFTQE--VSTKCGHIFCKKCIKNALSLQAKCPTCRKKITVKDLIRVFL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 19/38 (50%)
AT3G07200NP_001078119.1 RING 127..168 CDD:238093 20/42 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4259
eggNOG 1 0.900 - - E1_KOG0320
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2572
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431236at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 1 1.000 - - mtm1215
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.