DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and COP1

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_016857548.1 Gene:COP1 / 64326 HGNCID:17440 Length:775 Species:Homo sapiens


Alignment Length:186 Identity:48/186 - (25%)
Similarity:71/186 - (38%) Gaps:46/186 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SGSSERNPNEYYGDS-DSSSSSRSIDRTPFLLEYSSDSESS------------------------ 117
            |||:..:|......| .|:|||.|...:|..:..|:.:..|                        
Human     9 SGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLVAPA 73

  Fly   118 -SSSDSESSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPP------NKRIKSDDEESKKSVLP 175
             |.|...:.||.:| ..|.::..|:...|.:.|..|.....|      |..|.|.:::|...|  
Human    74 VSGSGGGAVSTGLS-RHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFV-- 135

  Fly   176 YNCPVCLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLCG--VDE-----PEF 224
              ||:|.:.:.|  ...|.|||.||..||.::::....||.|.  ||.     |.|
Human   136 --CPICFDMIEE--AYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 14/38 (37%)
COP1XP_016857548.1 RING-HC_COP1 132..177 CDD:319418 16/50 (32%)
PLN00181 <240..725 CDD:177776
WD40 repeat 491..528 CDD:293791
WD40 repeat 535..571 CDD:293791
WD40 repeat 576..614 CDD:293791
WD40 repeat 620..659 CDD:293791
WD40 repeat 663..685 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.