DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment elfless and RNF125

DIOPT Version :9

Sequence 1:	NP_001163003.1	Gene:	elfless / 35076	FlyBaseID:	FBgn0032660	Length:	229	Species:	Drosophila melanogaster
Sequence 2:	NP_060301.2	Gene:	RNF125 / 54941	HGNCID:	21150	Length:	232	Species:	Homo sapiens

Alignment Length:	77	Identity:	26/77 - (33%)
Similarity:	44/77 - (57%)	Gaps:	5/77 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   144 MGHTESSDSNEDSPPNKRIKSDD--EESKKSVLPYNCPVCLEDVREKLPVSTNCGHVFCKACIKR 206
            ||...|:||.:.:|.:...::.:  .:.:..|..::|.||||.:.:  ||.|.||||||::||..
Human     1 MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQ--PVRTRCGHVFCRSCIAT 63

  Fly   207 AVDTGR-VCPLC 217
            ::...: .||.|
Human    64 SLKNNKWTCPYC 75

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
elfless	NP_001163003.1	RING	178..217	CDD:214546	18/39 (46%)
RNF125	NP_060301.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..23		6/21 (29%)
		RING-HC_RNF125	35..76	CDD:319456	19/43 (44%)
		Interaction with the C2HC RNF-type zinc finger. /evidence=ECO:0000269\|PubMed:27411375	43..45		0/1 (0%)
		zf_C2HC_14	94..126	CDD:408358
		Interaction with the RING-type zinc finger. /evidence=ECO:0000269\|PubMed:27411375	109..113
		Linker region. /evidence=ECO:0000269\|PubMed:27411375	120..128
		zf-Di19	141..>173	CDD:398954
		Required for interaction with ubiquitin and for autoubiquitination. /evidence=ECO:0000269\|PubMed:17990982	210..224
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S4347
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.860