DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and rnf4

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001016554.1 Gene:rnf4 / 549308 XenbaseID:XB-GENE-1016982 Length:188 Species:Xenopus tropicalis


Alignment Length:182 Identity:47/182 - (25%)
Similarity:78/182 - (42%) Gaps:37/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SGSSERNPNEYYGDSDSSSSSRSIDRTPFLLEYSSD-----SESSSSSDSESSSTSISFDSSMSS 137
            |.||:|.       :..|:::.:....|..||...:     .||:.....:.::..:|.:.|:..
 Frog    14 SKSSKRR-------APGSTAAMTAATEPIELESGEEVVDLTCESTEPVVVDLTNNDLSINDSVVI 71

  Fly   138 TES--------STPMGHTES---SDSNEDS------PPNKRIKSDD-EESKKSVLPYNCPVCLED 184
            .|.        |.|...|.|   |..:|||      ..||.|.|.. ..|:.|....:||:|::.
 Frog    72 VEDTPRQRRALSRPSQQTTSCVLSSDDEDSRHADHFAANKDISSQAYGSSRSSSGKVSCPICMDS 136

  Fly   185 VRE-----KLPVSTNCGHVFCKACIKRAVDTGRVCPLC--GVDEPEFHRIFL 229
            ..|     :|.|||.|||:||..|::.|:.....||.|  .::..::|.|::
 Frog   137 YSEIVQSGRLIVSTKCGHIFCSQCLRDALKNAPSCPTCRKKLNHKQYHPIYV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 17/43 (40%)
rnf4NP_001016554.1 zf-RING_2 129..175 CDD:290367 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431236at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.