DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and dgrn

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster


Alignment Length:251 Identity:67/251 - (26%)
Similarity:113/251 - (45%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDSSDSDSSTEWEQNTRVISLPFSRNRSH------------LSSRLSYL------VGLQMENFR 47
            :|::|:...|.:......:.:|..|...:|            :.:.|..:      |..|::.|.
  Fly    97 VGEASNQLQSPQSNNPLNMANLSVSTEDAHSQIRSLTQDVIQMEAELDRMNRYCEEVVAQIDTFA 161

  Fly    48 TSNNSGVSQRI-HNTGPTPVLAPSGL-RSRLLSGSSERNPNEYYGDSDSSSSSRSIDRTPFLLEY 110
            |..::..::|| ..|.|..|:..|.| |:..:..:..|:|:.:. |..:....||  ||..|  :
  Fly   162 TRTSTPTTRRIRRRTSPVEVIDLSHLDRAPPVRSARNRDPDAFI-DLCTPEGPRS--RTVNL--H 221

  Fly   111 SSDSESSSSSDSESSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPPNKRIKSDDEESKKSVLP 175
            |:||.:.....|..:...:..|.:                     ||| ||:..|.:||:|..| 
  Fly   222 SNDSLTILPRRSAENDPVVDLDVA---------------------SPP-KRVNRDIDESQKEEL- 263

  Fly   176 YNCPVCLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLCG--VDEPEFHRIFL 229
            |.||:|::.|.::.||||.||||||:.||:.|:.....||:|.  :...:|.||:|
  Fly   264 YKCPICMDSVSKREPVSTKCGHVFCRECIETAIRATHKCPICNKKLTARQFFRIYL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 19/38 (50%)
dgrnNP_649596.1 RING 266..305 CDD:214546 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I4259
eggNOG 1 0.900 - - E1_KOG0320
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431236at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 1 1.000 - - mtm6557
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2891
65.910

Return to query results.
Submit another query.