powered by:
Protein Alignment elfless and CG33552
DIOPT Version :9
Sequence 1: | NP_001163003.1 |
Gene: | elfless / 35076 |
FlyBaseID: | FBgn0032660 |
Length: | 229 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001014488.1 |
Gene: | CG33552 / 3346220 |
FlyBaseID: | FBgn0053552 |
Length: | 157 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 20/69 - (28%) |
Similarity: | 31/69 - (44%) |
Gaps: | 10/69 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 152 SNEDSPPNKRIKSDDEESKKSVLPYNCPVC---LEDVREKLPVSTNCGHVFCKACIKRAVDTGRV 213
:|:....:.:.|...||:| |.:| .|...:..|||..|||:|...||...:...:.
Fly 70 ANQAENLSMKRKKIAEENK-------CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKT 127
Fly 214 CPLC 217
||:|
Fly 128 CPIC 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
elfless | NP_001163003.1 |
RING |
178..217 |
CDD:214546 |
14/41 (34%) |
CG33552 | NP_001014488.1 |
zf-RING_2 |
87..132 |
CDD:290367 |
16/52 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001208 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.