DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and CG31807

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_723984.1 Gene:CG31807 / 318953 FlyBaseID:FBgn0051807 Length:155 Species:Drosophila melanogaster


Alignment Length:119 Identity:25/119 - (21%)
Similarity:50/119 - (42%) Gaps:18/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SDSESSSSSDSESSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPPNKRI-------KSDDE-- 167
            ::.:.|...|.:.:..:|:........|....:.:     ..|:...|:::       :|.||  
  Fly    25 AERKKSEQKDKQLAKLNITTQEKDKMREEELKLYY-----QMEEEITNQKLLQEQLLFESKDELT 84

  Fly   168 -ESKKSVLPYNCPVCLEDVREK---LPVSTNCGHVFCKACIKRAVDTGRVCPLC 217
             :.:|..:...|.:||:....|   ..||..|||:|.:.||:..:....:||:|
  Fly    85 QQLEKIAIENTCCICLDPWEAKDHHRLVSLRCGHLFGEMCIRTHLQHADMCPIC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 14/41 (34%)
CG31807NP_723984.1 zf-RING_2 94..139 CDD:290367 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.