DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and Rnf4

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_062055.1 Gene:Rnf4 / 29274 RGDID:3583 Length:194 Species:Rattus norvegicus


Alignment Length:198 Identity:45/198 - (22%)
Similarity:76/198 - (38%) Gaps:54/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SERNP-NEYYGDSDSSSSSRSIDRTPFLLEYSSDSESSSSSDSESSSTSISFDSSMSSTESSTP- 143
            |.||| .:..|.:.:|..::...|     |.:|..|.|..::......::..:....:.||..| 
  Rat     2 STRNPQRKRRGGAVNSRQTQKRTR-----ETTSTPEISLEAEPIELVETVGDEIVDLTCESLEPV 61

  Fly   144 ---MGHTESSDSNEDSPPNKR--------------IKSDDEESKKSVLPY--------------- 176
               :.|.:|....|:....:|              :.|||||..|....|               
  Rat    62 VVDLTHNDSVVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSKDKDVYVTTHTPRSTKDEGTT 126

  Fly   177 --------NCPVCLEDVRE-----KLPVSTNCGHVFCKACIKRAVDTGRVCPLC--GVDEPEFHR 226
                    :||:|::...|     :|.|||.||||||..|::.::.....||.|  .::...:|.
  Rat   127 GLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHP 191

  Fly   227 IFL 229
            |::
  Rat   192 IYI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 17/43 (40%)
Rnf4NP_062055.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 11/38 (29%)
Required for ubiquitination activity. /evidence=ECO:0000250 1..20 6/17 (35%)
Mediates interaction with TRPS1. /evidence=ECO:0000250 6..65 11/63 (17%)
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 40..43 0/2 (0%)
SUMO interaction motif 2. /evidence=ECO:0000269|PubMed:18408734 50..53 0/2 (0%)
SUMO interaction motif 3. /evidence=ECO:0000269|PubMed:18408734 61..63 0/1 (0%)
SUMO interaction motif 4. /evidence=ECO:0000269|PubMed:18408734 71..74 0/2 (0%)
RING-HC_RNF4 131..184 CDD:319447 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11266
eggNOG 1 0.900 - - E1_KOG0320
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431236at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2891
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.