DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and Cop1

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_036061.1 Gene:Cop1 / 26374 MGIID:1347046 Length:733 Species:Mus musculus


Alignment Length:194 Identity:47/194 - (24%)
Similarity:73/194 - (37%) Gaps:60/194 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SGSSERNPNEYYGDSDSSSSSRSIDRTPFLLEYSSDSESSSS----------------------- 119
            |||:..:|......|.:|:|| |:..:|     |..|.::|:                       
Mouse     9 SGSAGTSPGSSAASSVTSASS-SLSSSP-----SPPSVAASAATLVSGGVAPAAGSGGLGGPGRP 67

  Fly   120 -------SDSESSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPPNKR----------IKSDDE 167
                   |.|.|:..::|...|..|. ::.|......|.|:..|...||          :.|.::
Mouse    68 VLVAAAVSGSASAGGAVSAGQSRLSC-AARPSAGVGGSSSSLGSSSRKRPLLVPLCNGLLNSYED 131

  Fly   168 ESKKSVLPYNCPVCLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLCG--VDE-----PEF 224
            :|...|    ||:|.:.:.|  ...|.|||.||..||.::::....||.|.  ||.     |.|
Mouse   132 KSNDFV----CPICFDMIEE--AYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNF 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 14/38 (37%)
Cop1NP_036061.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 12/39 (31%)
Nuclear localization signal 1 111..115 0/3 (0%)
zf-C3HC4 138..175 CDD:278524 14/38 (37%)
Nuclear localization signal 2 197..208
Nuclear export signal 237..247
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..327
WD 1 421..460
WD40 423..729 CDD:238121
WD 2 470..510
WD40 repeat 475..512 CDD:293791
WD 3 513..553
WD40 repeat 519..555 CDD:293791
WD 4 555..595
WD40 repeat 560..598 CDD:293791
WD 5 599..637
WD40 repeat 604..643 CDD:293791
WD 6 640..679
Interaction with TRIB1. /evidence=ECO:0000250|UniProtKB:Q8NHY2 645..647
WD40 repeat 647..669 CDD:293791
WD 7 695..731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.