DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and slx8

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_595523.1 Gene:slx8 / 2540618 PomBaseID:SPBC3D6.11c Length:269 Species:Schizosaccharomyces pombe


Alignment Length:265 Identity:57/265 - (21%)
Similarity:97/265 - (36%) Gaps:87/265 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EQNTRVISLPFSRNRSHLSSRLSYLVGLQMENFRTSNNSGVSQRIHNTGPTPVLAPSGLRSRLLS 78
            :.|.|.:|.|:  |....|:|::            :.|:.:::|  .:.|......:|.      
pombe     8 DTNVRNLSAPY--NIPSQSARVA------------AGNAAINRR--RSSPVENSPGNGF------ 50

  Fly    79 GSSERNPNEYYGDSDSSSSSRSIDRTP-FLLEYSSDSESSSSSDSESSSTSISFDSSM------- 135
             ....:..:|...:.|.:.|..::|.| .|.|.:|:.....:...|:|..:|..:|.:       
pombe    51 -PVSEDATDYPSGTTSENESLPLNRAPRSLREVASELAQEETLPVETSDLNIDVESEVFDLEDIN 114

  Fly   136 ------------------SSTESS---------TPMGHTESSDSNED----------------SP 157
                              :|.|:|         .|...::..|..::                |.
pombe   115 FQNDADDINQRFTYNNHPASVENSLTNVNSIHAQPTTISDMIDLTDETSYDPRKQKFEQGKNPST 179

  Fly   158 PNKRIKSDDEESKKSVLP-------YNCPVCLEDVREKLPVSTNCGHVFCKACIKRAVDT---GR 212
            .|..|:. :|.|||.|:|       |.|.:|| |..|.|. .|.|||:||..||..|:.|   .:
pombe   180 TNAEIEK-EEPSKKQVVPSSQRLADYKCVICL-DSPENLS-CTPCGHIFCNFCILSALGTTAATQ 241

  Fly   213 VCPLC 217
            .||:|
pombe   242 KCPVC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 18/41 (44%)
slx8NP_595523.1 PEX10 1..260 CDD:227861 57/265 (22%)
RING 205..250 CDD:238093 19/44 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.