DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and T02C1.1

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_499044.1 Gene:T02C1.1 / 176305 WormBaseID:WBGene00011365 Length:160 Species:Caenorhabditis elegans


Alignment Length:40 Identity:16/40 - (40%)
Similarity:22/40 - (55%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CPVCLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLC 217
            |.|||:...|  |....|||.:|:.||:..::....||||
 Worm     8 CAVCLDFFVE--PCIIECGHSYCRFCIESHLNINEKCPLC 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 14/38 (37%)
T02C1.1NP_499044.1 zf-C3HC4 8..45 CDD:278524 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4347
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.