DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and T02C1.1

DIOPT Version :10

Sequence 1:NP_609860.2 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_499044.1 Gene:T02C1.1 / 176305 WormBaseID:WBGene00011365 Length:160 Species:Caenorhabditis elegans


Alignment Length:40 Identity:16/40 - (40%)
Similarity:22/40 - (55%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CPVCLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLC 217
            |.|||:...|  |....|||.:|:.||:..::....||||
 Worm     8 CAVCLDFFVE--PCIIECGHSYCRFCIESHLNINEKCPLC 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_609860.2 RING_Ubox 176..>215 CDD:473075 12/36 (33%)
T02C1.1NP_499044.1 rad18 3..>69 CDD:273165 16/40 (40%)

Return to query results.
Submit another query.