powered by:
Protein Alignment elfless and T02C1.1
DIOPT Version :9
Sequence 1: | NP_001163003.1 |
Gene: | elfless / 35076 |
FlyBaseID: | FBgn0032660 |
Length: | 229 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499044.1 |
Gene: | T02C1.1 / 176305 |
WormBaseID: | WBGene00011365 |
Length: | 160 |
Species: | Caenorhabditis elegans |
Alignment Length: | 40 |
Identity: | 16/40 - (40%) |
Similarity: | 22/40 - (55%) |
Gaps: | 2/40 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 CPVCLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLC 217
|.|||:...| |....|||.:|:.||:..::....||||
Worm 8 CAVCLDFFVE--PCIIECGHSYCRFCIESHLNINEKCPLC 45
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
elfless | NP_001163003.1 |
RING |
178..217 |
CDD:214546 |
14/38 (37%) |
T02C1.1 | NP_499044.1 |
zf-C3HC4 |
8..45 |
CDD:278524 |
14/38 (37%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S4347 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.