DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elfless and si:ch1073-440b2.1

DIOPT Version :9

Sequence 1:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_001340443.6 Gene:si:ch1073-440b2.1 / 100000190 ZFINID:ZDB-GENE-030131-8303 Length:749 Species:Danio rerio


Alignment Length:194 Identity:51/194 - (26%)
Similarity:82/194 - (42%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SQRIHNTGPTPVLAPSGLRSRLLSGSSERNPNEYYGDSDSSSSSRSIDRTPFLLEYSSDSESSSS 119
            :|:|.:...:.|....||.:.|.:.:|...|.     |..||.:..|.|        ..:::..|
Zfish   325 AQKILSHMFSSVFVNDGLATSLPACTSRIKPT-----SLLSSLNTIIPR--------DGTKAGCS 376

  Fly   120 SDSESSSTSISFDSSMSSTESSTPMG-------------HTESSDSNEDSPPNKRIKSDDEESK- 170
            .|...|.:.|. |.:...:|:...:|             .||:|..:|  ||:|::|.|...|. 
Zfish   377 KDLTLSCSKIK-DGNSQLSENVNCVGLSSLFIPPVLKRKWTENSKQSE--PPSKQLKEDHVFSSA 438

  Fly   171 --KSVLP--------YNCPVCLEDVREKLPVSTNCGHVFCKACIKRAVDTGRVCPLCGVDEPEF 224
              |..:|        :.|.:|:....|  ||:|.|||.||..|::|.:|....||||..:..|:
Zfish   439 VVKRQVPLQLLDNADFECSLCMRLFYE--PVTTPCGHTFCLKCLERCLDHNPNCPLCKENLSEY 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elflessNP_001163003.1 RING 178..217 CDD:214546 16/38 (42%)
si:ch1073-440b2.1XP_001340443.6 RING_Ubox 146..181 CDD:327409
TPR repeat 220..245 CDD:276809
TPR_11 230..>329 CDD:330823 1/3 (33%)
TPR repeat 250..280 CDD:276809
TPR repeat 285..308 CDD:276809
RAD18 446..>546 CDD:333230 19/57 (33%)
RING2-HC_LONFs 453..494 CDD:319428 17/42 (40%)
RING-HC finger (C3HC4-type) 456..493 CDD:319428 16/38 (42%)
LON_substr_bdg 544..745 CDD:308028
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.