DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and Pcdhb7

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_444362.3 Gene:Pcdhb7 / 93878 MGIID:2136741 Length:829 Species:Mus musculus


Alignment Length:693 Identity:169/693 - (24%)
Similarity:288/693 - (41%) Gaps:167/693 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 IDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRP-----QWRFTVFAQDEGGEGLVGYADIQVN 241
            :||:            |||:.:.:.:||::.....     .::.|:       |..|.|...::.
Mouse   108 LDPE------------TGDLLLREKVDREEVCSTVDPCVLHFQVTL-------EKPVQYFQGELL 153

  Fly   242 LKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIEEETGAP 306
            ::||||:||:||:|....|:.||...|:.:....|.|.|             :..|.:::.|.:|
Mouse   154 IQDINDHAPEFPEGEMLLNIPENSQPGTLLPLNLAQDLD-------------VGSNGLQQYTVSP 205

  Fly   307 IFEIE------------PETGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIR--VKDL 357
            .....            ||  |::..  .||||...:.|:.::|:|||....:|||.:|  :.|:
Mouse   206 NSHFHVLTRNNSEGKKYPE--LVQDR--ALDREEQAELSLTLIALDGGSPPRSGTALVRILIMDI 266

  Fly   358 NDMPPQFTKDEWVTEVDETNGTYIPETPILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRNGD 422
            ||..|:|....:..:|.|::   :|::|:|||..||.|..|           ||...:...:..|
Mouse   267 NDNAPEFVNSPYEVQVLESS---LPDSPVLTVFAQDADAGN-----------FGRVSYGFFQASD 317

  Fly   423 G----------TGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRD 477
            .          ||.:::.:.||:|.      .:| ..|..:..||.|.|.|     ..|:|::.|
Mouse   318 EIQRTFSINKVTGEIQLKKELDFEK------IKF-YHVKIEATDGGGLSGK-----GLVIVEVLD 370

  Fly   478 INDNVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYK-------IVRSTNRKRQFA 535
            :|||.|:.....:..|:.|:.. .||:..|:..|.|.|.::||...       |::||.:.....
Mouse   371 VNDNAPELTISSLTSSVPENAP-ETIISIFRVGDRDSGENAKVVCSIPENLPFILKSTFKNFYTL 434

  Fly   536 ISDRGAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQ-DYKPTLP 599
            ::       :.|||||::..::|.|:..|.|:|..|...|:||.|.|||||||.|.: .|...:.
Mouse   435 VT-------ESPLDRESRAEYNITIMVSDLGTPRLTTWHTITVQVSDVNDNAPAFTRTSYTMFVR 492

  Fly   600 ENVS-GKKILEVAAKDPDDRLRGNGGPFTFRL----DPLASDEIKAGFKVEYDRRGDNENGVAII 659
            ||.| ...|..::|.|.|.   |:....|:.|    ||    |:.....:..:.    :||.  :
Mouse   493 ENNSPALHIGTISATDSDS---GSNAHITYSLLLPHDP----ELPLSSLISINA----DNGQ--L 544

  Fly   660 SSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTIGDVNDN--------------------- 703
            .:||..|.|..:::...:...|.|:.|::..:.:.|.:.|.|||                     
Mouse   545 FALRALDYEVLQAFEFHVGATDRGSSALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLPR 609

  Fly   704 KMQPG---SKSVLVYNYQGQSQDTPIGRVYVNDPDDWDVPDKKYYWEVQEHQRFKLDTDTGILTM 765
            ..:||   :|.|.|....||:.......:...:|..:.|      |......|          |.
Mouse   610 AAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSV------WAHNGEVR----------TS 658

  Fly   766 RAGTRRGRYQLRFKVYDREHGQEDIPANLSVTVRDITAEAVQQ 808
            |..:.|...:.|..:..:::|:.  |.:.|||:..:..:...|
Mouse   659 RLLSERDAPKHRLLMLVKDNGEP--PRSASVTLHVLLVDGFSQ 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 14/70 (20%)
Cadherin_repeat 256..359 CDD:206637 27/116 (23%)
Cadherin_repeat 379..481 CDD:206637 28/111 (25%)
Cadherin_repeat 489..586 CDD:206637 31/103 (30%)
Cadherin_repeat 594..703 CDD:206637 26/113 (23%)
Cadherin_repeat 724..801 CDD:206637 13/76 (17%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Pcdhb7NP_444362.3 Cadherin_2 63..143 CDD:285466 8/53 (15%)
Cadherin_repeat 171..269 CDD:206637 28/114 (25%)
Cadherin_repeat 277..374 CDD:206637 30/122 (25%)
Cadherin_repeat 386..478 CDD:206637 31/99 (31%)
Cadherin_repeat 486..588 CDD:206637 26/114 (23%)
Cadherin_repeat 607..695 CDD:206637 20/105 (19%)
Cadherin_C_2 719..801 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.