DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and Pcdhgc5

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_291061.1 Gene:Pcdhgc5 / 93708 MGIID:1935205 Length:944 Species:Mus musculus


Alignment Length:702 Identity:178/702 - (25%)
Similarity:293/702 - (41%) Gaps:106/702 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ENADLQSTVLTVNAKDHNESTNIRYQITGGNIGNAFAVQNTTGVIYVASPLDYET----RPRYEL 107
            :..||.|..|.:.::::               |..|::...:|.:.|:..:|.|:    .....|
Mouse    55 KGTDLLSRRLRLGSEEN---------------GRYFSLSLVSGALAVSQKIDRESLCGASTSCLL 104

  Fly   108 RLEATRNRKNNYTTVVINVRDVNDNPPVFDRQTYRTQITEEDDRNLPKRILQVTATDGDVDRPIN 172
            .::.........|.|.:.:.|:|||.|.|.......:|:|.....  .|....:|.|.||.  .|
Mouse   105 PVQVVTE
HPLELTRVEVEILDLNDNSPSFATPDREMRISESAAPG--ARFPLDSAQDPDVG--TN 165

  Fly   173 IVYFLTGQGIDPDNPANSKFDINRTT---GDIF---VL-KPLDRDQPNGRPQWRFTVFAQDEGGE 230
            .|.|.|   :.|    ||.|.::..|   |.:|   || :.|||:.   :.:.:..:.|.|.|..
Mouse   166 TVSFYT---LSP----NSHFSLHVKTLKDGKLFPELVLEQQLDRET---QARHQLVLTAVDGGTP 220

  Fly   231 GLVGYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIE 295
            ...|.:.|.|.:.|:|||||.|...:....:.||...|:.::.::|.   ||:|.||.:|.||..
Mouse   221 ARSGTSLISVIVLDVNDN
APTFQSSVLRVGLPENTPPGTLLLRLNAT---DPDEGTNGQLDYSFG 282

  Fly   296 KNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMDGG--GLKGTGTASIRVKDLN 358
            .:.  .||...:|.::|.:|.|. .:..:|.|.:..|.|...|.|.|  .::|.....:.|.|.|
Mouse   283 DHT--SETVKNLFGLDPSSGAIH-VLGPVDFEESNFYEIHARARDQGQPAMEGHCVIQVDVGDAN 344

  Fly   359 DMPPQFTKDEWVTEVDETNGTYIPETPILTV----TVQDED--ETNTFQYKVVPNSGFGADKFAM 417
            |.||:......|..|.|:       ||:.||    .|:|.|  .......|..||..|      .
Mouse   345 DN
PPEVLLASLVNPVLES-------TPVGTVVGLFNVRDRDSGRNGEVSLKTSPNLPF------Q 396

  Fly   418 VRNGDGTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNV 482
            ::..:...||...||||.|   .:|.:...:..:|      .||...| .:..:.:.:.|:|||.
Mouse   397 IKPSENHYSLLTSQPLDRE---ATSHYTIELLASD------AGSPPLH-THLTLRLNISDVNDNA 451

  Fly   483 PKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQ-----FAISDRGAV 542
            |.|.::.....|.|:...|::|....|:|.|:|.::::.|.||.|..:...     :...:.|.:
Mouse   452 PHFTQQLYTAYIPENRPPGSLLCTVAASDPDEGDNARLTYSIVGSQIQGAPASSFVYVNPEDGRI 516

  Fly   543 SIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDYKP--------TLP 599
            ..||..|.|......|.:...|.|||...|..:|.|.|.|.|||||..... :|        .||
Mouse   517 FAQRTFDYELLQMLQIVVGVRDSGSPRLHANTSLHVFVLDQNDNAPAVLHP-RPGREFSAPQRLP 580

  Fly   600 ENV-SGKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIISSLR 663
            .:. .|..:.:|.|.|.|   .|:....::.|.|.::   ..|..:.....|:.....|::..  
Mouse   581 RSAPPGSLVTKVTAVDAD---AGHNAWLSYSLLPQST---APGLFLVSAHTGEVRTARALLED-- 637

  Fly   664 PFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTIGDVNDNKMQPGSKSVLVY 715
              |.:.|:   :.:.::|||.|:::.|:|:.:.:.| .|.:..|.|...|.:
Mouse   638 --DSDTQQ---VVVLVRDNGDPSLSSTATVLLVLED-EDAEEMPKSSDFLTH 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 15/88 (17%)
Cadherin_repeat 140..248 CDD:206637 31/114 (27%)
Cadherin_repeat 256..359 CDD:206637 28/104 (27%)
Cadherin_repeat 379..481 CDD:206637 25/107 (23%)
Cadherin_repeat 489..586 CDD:206637 28/101 (28%)
Cadherin_repeat 594..703 CDD:206637 23/117 (20%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Pcdhgc5NP_291061.1 Cadherin_2 30..111 CDD:285466 11/70 (16%)
Cadherin_repeat 139..238 CDD:206637 31/112 (28%)
Cadherin_repeat 246..346 CDD:206637 29/105 (28%)
Cadherin_repeat 359..450 CDD:206637 27/113 (24%)
Cadherin_repeat 459..560 CDD:206637 28/100 (28%)
Cadherin_repeat 578..670 CDD:206637 22/105 (21%)
Cadherin_C_2 689..791 CDD:293101
Cadherin_tail 821..>917 CDD:292596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.