DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and PCDHGB4

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_003727.1 Gene:PCDHGB4 / 8641 HGNCID:8711 Length:923 Species:Homo sapiens


Alignment Length:694 Identity:185/694 - (26%)
Similarity:289/694 - (41%) Gaps:125/694 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IRYQI-----TGGNIGNA------------------------FAVQNTTGVIYVASPLDYE---- 100
            |||:|     .|..:||.                        |.|...:|.:.|:|.||.|    
Human    33 IRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICG 97

  Fly   101 TRPRYELRLEATRNRKNNYTTVVINVRDVNDNPPVFDRQTYRTQITEEDDRNLPKRILQVTATDG 165
            .:|...|..||......|:..|.:.:.|:||:.|.|.:.::..||:|.....  .|.:..:|.|.
Human    98 KKPACALEFEAVAEN
PLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPG--TRFILGSAHDA 160

  Fly   166 DVDRPINIVYFLTGQGIDPDNPANSKFDINRTTGD-----IFVLK-PLDRDQPNGRPQWRFTVFA 224
            |:.......|.|        :|::....||:...|     ..||| ||||::   :..:..|:.|
Human   161 DIGSNTLQNYQL--------SPSDHFSLINKEKSDGSKYPEMVLKTPLDREK---QKSYHLTLTA 214

  Fly   225 QDEGGEGLVGYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAK 289
            .|.|...|...|.|.|.:.|.|||||.|.|.:|..:::||...|::|:.::|.|.|   |..||:
Human   215 LDFGAPPLSSTAQIHVLVTDANDN
APVFSQDVYRVSLSENVYPGTTVLQVTATDQD---EGVNAE 276

  Fly   290 LIYSIEKNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIRV 354
            :.:|     ..|.:....|::...||.| |.:..||.|...:|||.:.|.||||:....|..:.|
Human   277 ITFS-----FSEASQITQFDLNSNTGEI-TVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEV 335

  Fly   355 KDLNDMPPQ--FTKDEWVTEVDETNGTYIPETPILTVTVQDEDETNTFQYKV---VPNSGFGADK 414
            .|.||..|:  |.....:...|...||:|   .:|.|..:|.........|:   ||        
Human   336 IDENDN
APEVIFQSLPNLIMEDAELGTHI---ALLKVRDKDSRHNGEVTCKLEGDVP-------- 389

  Fly   415 FAMVRNGDGTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDIN 479
            |.::.:...|..|.....||.|   |:..:...:...|:|......|       |.:.:.:.|:|
Human   390 FKILTSSRNTYKLVTDAVLDRE---QNPEYNITVTATDRGKPPLSSS-------SSITLHIGDVN 444

  Fly   480 DNVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFA-----ISDR 539
            ||.|.|.:....|.:.|:...|..:.|.:|:|.|.|.:.:|:|.|:.|...:|:.:     .::.
Human   445 DN
APVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAES 509

  Fly   540 GAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQ-----------D 593
            |.|..||..|.|......:.:.|.|.||||.:|..:|.|:|.|.|||||....           |
Human   510 GVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFD 574

  Fly   594 YKPTLPENVSGKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDE---IKAGFKVEYDRRGDNENG 655
            ..|...|  .|..:.:|.|.|.|.   |:....::.:  |.:.|   ...|.     |.|:....
Human   575 MVPHAAE--PGYLVTKVVAVDADS---GHNAWLSYHV--LQASEPGLFSLGL-----RTGEVRTA 627

  Fly   656 VAIISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTIGD 699
            .|:      .||:|.:...: :.::|.|.|.::.|:||.:...|
Human   628 RAL------GDRDAVRQRLL-VAVRDGGQPPLSATATLHLVFAD 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 23/95 (24%)
Cadherin_repeat 140..248 CDD:206637 30/113 (27%)
Cadherin_repeat 256..359 CDD:206637 32/102 (31%)
Cadherin_repeat 379..481 CDD:206637 21/104 (20%)
Cadherin_repeat 489..586 CDD:206637 31/101 (31%)
Cadherin_repeat 594..703 CDD:206637 24/109 (22%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
PCDHGB4NP_003727.1 Cadherin_2 32..112 CDD:285466 19/78 (24%)
Cadherin_repeat 137..238 CDD:206637 30/113 (27%)
Cadherin_repeat 246..341 CDD:206637 33/103 (32%)
Cadherin_repeat 354..446 CDD:206637 23/112 (21%)
Cadherin_repeat 454..556 CDD:206637 31/101 (31%)
Cadherin_repeat 580..660 CDD:206637 22/98 (22%)
Cadherin_C_2 685..766 CDD:293101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 797..832
Cadherin_tail 800..>896 CDD:292596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 893..923
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.