DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CadN2 and cdh18a

DIOPT Version :9

Sequence 1:	NP_001036368.2	Gene:	CadN2 / 35071	FlyBaseID:	FBgn0262018	Length:	1799	Species:	Drosophila melanogaster
Sequence 2:	NP_001070203.1	Gene:	cdh18a / 767768	ZFINID:	ZDB-GENE-060929-316	Length:	108	Species:	Danio rerio

Alignment Length:	87	Identity:	18/87 - (20%)
Similarity:	28/87 - (32%)	Gaps:	38/87 - (43%)

- Green bases have known domain annotations that are detailed below.

  Fly  1239 CVASLVQAKCHCQPGWMGPGCNVPTIPTTFKAQSYVKFALSFEPDRFSTQLQLRFRTREQGGELF 1303
            |::.|:...|..|..:..|.   |..||                  ||..     :|:...|:
Zfish     9 CLSPLLLCLCVLQRSYGTPS---PPSPT------------------FSHN-----QTKLPNGD-- 45

  Fly  1304 RVSDQHHR--------EYAILE 1317
              .|.|||        ::.:||
Zfish    46 --KDSHHRPKRGWIWNQFFVLE 65

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CadN2	NP_001036368.2	Cadherin_repeat	41..132	CDD:206637
		Cadherin_repeat	140..248	CDD:206637
		Cadherin_repeat	256..359	CDD:206637
		Cadherin_repeat	379..481	CDD:206637
		Cadherin_repeat	489..586	CDD:206637
		Cadherin_repeat	594..703	CDD:206637
		Cadherin_repeat	724..801	CDD:206637
		EGF_CA	977..1010	CDD:238011
		LamG	1013..1198	CDD:238058
		EGF_2	<1233..1259	CDD:285248	5/19 (26%)
		Laminin_G_2	1293..1428	CDD:280389	8/33 (24%)
		EGF_CA	1497..1535	CDD:238011
		Cadherin_C	1583..1719	CDD:279398
cdh18a	NP_001070203.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24027
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	2.010