DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and PCDHA2

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_061728.1 Gene:PCDHA2 / 56146 HGNCID:8668 Length:948 Species:Homo sapiens


Alignment Length:663 Identity:176/663 - (26%)
Similarity:285/663 - (42%) Gaps:93/663 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YQITGGNIGNAFAVQNTTGVIYVASPLDYE----TRPRYELRLEATRNRKNNYTTVVINVRDVND 131
            :::.....|:...|....|:::|.|.:|.|    ......:.:|...:|......|.:.|:|:||
Human    64 FRVASKRHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHVEVIVDRPLQVFHVEVEVKDIND 128

  Fly   132 NPPVFDRQTYRTQITEEDDRNLPKRILQVTATDGDVDRPINIV----------YFLTGQGIDPDN 186
            |||:|. .|.:| |...:.|.|..|.....|:|.|:.  :|.:          :||       |.
Human   129 NPPIFP-MTVKT-IRFPESRLLDSRFPLEGASDADIG--VNALLSYKLSSSEFFFL-------DI 182

  Fly   187 PANSKFDINRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQ 251
            .||.:...:.:   :.:.|.|||::   ..:....:.|.|.|...|.|...|.:.:.|:|||.|.
Human   183 QANDELSESLS---LVLGKSLDREE---TAEVNLLLVATDGGKPELTGTVQILIKVLDVNDNEPT 241

  Fly   252 FPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIEEETGAPIFEIEPETGL 316
            |.|.:|...:.||...|:.|:.::|.|.|   |..|::::||:..:|  ..|....|.|:|.:|.
Human   242 FAQSVYKVKLLENTANGTLVVKLNASDAD---EGPNSEIVYSLGSDV--SSTIQTKFTIDPISGE 301

  Fly   317 IKTAVCCLDRERTPDYSIQVVAMDGG--GLKGTGTASIRVKDLNDMPPQFTKDEWVTEVDE--TN 377
            |:|. ..||.|....|.|||.|.|.|  .:.|....|:::.|:||..|:.:.......:.|  :.
Human   302 IRTK-GKLDYEEAKSYEIQVTATDKGTPSMSGHCKISLKLVDINDNTPEVSITSLSLPISENASL 365

  Fly   378 GTYIPETPILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRNGDGTGSLKIIQPLDYEDPLQSS 442
            ||.|   .::||:.:|..........:.|:.     .|.:|.......||.:...||.|   ..|
Human   366 GTVI---ALITVSDRDSGTNGHVTCSLTPHV-----PFKLVSTFKNYYSLVLDSALDRE---SVS 419

  Fly   443 GFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILEQF 507
            .:...:...|      |||.......| |.:::.|:|||.|.|.:....|.:.|:...|..:...
Human   420 AYELVVTARD------GGSPSLWATTS-VSIEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTV 477

  Fly   508 KATDADQGGHSKVAYKIVRSTNRKRQFAIS-------DRGAVSIQRPLDRETQDRHHIQILAIDD 565
            .|.|||...::.|:|.:|.  .|..:.|:|       :.|.|...:|||.|..:....|:.|.|.
Human   478 SAWDADAQENALVSYSLVE--RRVGERALSSYVSVHAESGKVYALQPLDHEEVELLQFQVSARDA 540

  Fly   566 GSPARTATATLTVIVKDVNDNAP--------TFAQDYKPTLPENV-SGKKILEVAAKDPDDRLRG 621
            |.|...:..||.|.|.|.|||||        |.|......:|.:| :|..:.:|.|.|.|.   |
Human   541 GVPPLGSNVTLQVFVLDENDNAPALLAPRAGTAAGAVSELVPWSVGAGHVVAKVRAVDADS---G 602

  Fly   622 NGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGV--AIISSLRPFDREAQKSYAIPIEIKDNGA 684
            .....::.|. |.:...:..|:|          |:  ..||:.|..|......:.:.:.:||:|.
Human   603 YNAWLSYELQ-LGTGSARIPFRV----------GLYTGEISTTRALDEADSPRHRLLVLVKDHGE 656

  Fly   685 PAMTGTSTLTVTI 697
            ||:|.|:|:.|::
Human   657 PALTATATVLVSL 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 13/64 (20%)
Cadherin_repeat 140..248 CDD:206637 27/117 (23%)
Cadherin_repeat 256..359 CDD:206637 33/104 (32%)
Cadherin_repeat 379..481 CDD:206637 22/101 (22%)
Cadherin_repeat 489..586 CDD:206637 30/103 (29%)
Cadherin_repeat 594..703 CDD:206637 26/107 (24%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
PCDHA2NP_061728.1 Cadherin_2 30..111 CDD:285466 8/46 (17%)
Cadherin_repeat 139..238 CDD:206637 26/114 (23%)
Cadherin_repeat 246..346 CDD:206637 34/105 (32%)
Cadherin_repeat 354..451 CDD:206637 24/114 (21%)
Cadherin_repeat 459..561 CDD:206637 30/103 (29%)
Cadherin_repeat 581..670 CDD:206637 26/103 (25%)
5 X 4 AA repeats of P-X-X-P 734..892
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 754..801
Cadherin_tail 797..940 CDD:292596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 829..854
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 868..948
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.