DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and PCDHB4

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_061761.1 Gene:PCDHB4 / 56131 HGNCID:8689 Length:795 Species:Homo sapiens


Alignment Length:552 Identity:144/552 - (26%)
Similarity:245/552 - (44%) Gaps:89/552 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 KFDINRTTGDIFVLKPLDRDQPNGRPQ---WRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQF 252
            :..::|.|||:.:.:.|||::..|..:   ..|.||.     |..|.:...::.::||||::|.|
Human    73 RLQLDRQTGDLLLREKLDREELCGPIEPCVLHFQVFL-----EMPVQFFQGELLIQDINDHSPIF 132

  Fly   253 PQGIYFGNVTENGTAGSSVMTMSAVDYD-----------DPNESTNAKLIYSIEKNVIEEETGAP 306
            |:......:.||...|:....:.|.|.|           .||..     .:.:.:|..|.:....
Human   133 PEREVLLKILENSQPGTLFPLLIAEDLDVGSNGLQKYTISPNSH-----FHILTRNHSEGKKYPD 192

  Fly   307 IFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIR--VKDLNDMPPQFTKDEW 369
            :.:.:|           ||||..|::|:.:||:|||....:||..:|  :.|:||..|:|....:
Human   193 LVQDKP-----------LDREEQPEFSLTLVALDGGSPPRSGTVMVRILIMDINDNAPEFVHTPY 246

  Fly   370 VTEVDETNGTYIPETPILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRNGDG----------T 424
            ..:|.|.:..   ::||:.|..:|.|..|           ||:..:.:.:..|.          |
Human   247 GVQVLENSPL---DSPIVRVLARDIDAGN-----------FGSVSYGLFQASDEIKQTFSINEVT 297

  Fly   425 GSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREH 489
            |.:.:.:.||:| .::|    :.:::  :..||.|.|.|     ..||:::.|:|||.|:.....
Human   298 GEILLKKKLDFE-KIKS----YHVEI--EATDGGGLSGK-----GTVVIEVVDVNDNPPELIISS 350

  Fly   490 IEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRGAVSIQRPLDRETQD 554
            :..||.|:.. .|::..|:..|.|.|.:.|:...|..:.....:..:.:...:..:|||||||..
Human   351 LTSSIPENAP-ETVVSIFRIRDRDSGENGKMICSIPDNLPFILKPTLKNFYTLVTERPLDRETSA 414

  Fly   555 RHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQ-DYKPTLPENVSGKKILEVAAKDPDDR 618
            .::|.|...|.|:|.......:||.|.|||||||.|.| .|...:.||.|  ..|.:.:....||
Human   415 EYNITIAVTDLGTPRLKTQQNITVQVSDVNDNAPAFTQTSYTLFVRENNS--PALHIGSVSATDR 477

  Fly   619 LRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIISSLRPFDREAQKSYAIPIEIKDNG 683
            ..|.....|:.|.|.....:.....|..:  .||.:    :.:||..|.||.:::...:...|.|
Human   478 DSGTNAQVTYSLLPPQDPHLPLASLVSIN--ADNGH----LFALRSLDYEALQAFEFRVGASDRG 536

  Fly   684 APAMTGTSTLTVTIGDVNDNK------MQPGS 709
            :||::..:.:.|.:.|.|||.      :|.||
Human   537 SPALSSEALVRVLVLDTNDNSPFVLYPLQNGS 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 16/59 (27%)
Cadherin_repeat 256..359 CDD:206637 26/115 (23%)
Cadherin_repeat 379..481 CDD:206637 24/111 (22%)
Cadherin_repeat 489..586 CDD:206637 28/96 (29%)
Cadherin_repeat 594..703 CDD:206637 26/108 (24%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
PCDHB4NP_061761.1 Cadherin_2 29..110 CDD:285466 11/41 (27%)
Cadherin_repeat 139..237 CDD:206637 27/113 (24%)
Cadherin_repeat 245..342 CDD:206637 26/122 (21%)
Cadherin_repeat 354..446 CDD:206637 28/92 (30%)
Cadherin_repeat 454..556 CDD:206637 26/109 (24%)
Cadherin_repeat 575..663 CDD:206637
Cadherin_C_2 684..767 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.