DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and PCDHB13

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_061756.1 Gene:PCDHB13 / 56123 HGNCID:8684 Length:798 Species:Homo sapiens


Alignment Length:726 Identity:184/726 - (25%)
Similarity:307/726 - (42%) Gaps:126/726 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FVRIGIADKNDSPPYFDRFLYETEIDENADLQSTVLTVNAKD----HNESTNIRYQITGGNIGNA 81
            |:.:|::....:.|.....:.|||       .|:.:|..|||    ..|.:....::.  :.||.
Human    18 FLLLGLSLAGAAEPRSYSVVEETE-------GSSFVTNLAKDLGLEQREFSRRGVRVV--SRGNK 73

  Fly    82 FAVQ--NTTGVIYVASPLDYE-----TRP---RYELRLEATRNRKNNYTTVVINVRDVNDNPPVF 136
            ..:|  ..|..:.:...||.|     |.|   |:::.||:    ...:....:.|.|:||:.|||
Human    74 LHLQLNQETADLLLNEKLDREDLCGHTEPCVLRFQVLLES----PFEFFQAELQVIDINDHSPVF 134

  Fly   137 -DRQTYRTQITEEDDRNLPKRILQV-TATDGDVDRPINIVYFLTGQGIDPDNPANSKFDI---NR 196
             |:|    .:.:..:.:.|.....: .|.|.||.:. ||..::    |.|    ||.|.:   .|
Human   135 LDKQ----MLVKVSESSPPGTTFPLKNAEDLDVGQN-NIENYI----ISP----NSYFRVLTRKR 186

  Fly   197 TTG----DIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQFPQGIY 257
            :.|    ::.:.|.|||::   ..:.|.|:.|.|.|.....|.|.:.:.:.|:|||||:|.|..|
Human   187 SDGRKYPELVLDKALDREE---EAELRLTLTALDGGSPPRSGTAQVYIEVLDVNDNAPEFEQPFY 248

  Fly   258 FGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIEEETGAPIFEIEPETGLIKTAVC 322
            ...::|:...|..|:.:||.|.|   ...|.::.||:.:  ..||.| ..|:|.|.||.|:... 
Human   249 RVQISEDSPVGFLVVKVSATDVD---TGVNGEISYSLFQ--ASEEIG-KTFKINPLTGEIELKK- 306

  Fly   323 CLDRERTPDYSIQVVAMDGGGLKGTGTASIRVKDLNDMPPQFTKDEWVTEVDETNGTYIPETPIL 387
            .||.|:...|.:.:.|.|.|...|..|..|:|.|:||..|:.|...:.:.:.|.    .|||.:.
Human   307 QLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVIDVNDHAPEVTMSAFTSPIPEN----APETVVA 367

  Fly   388 TVTVQDED--ETNTFQYKVVPNSGFGADKFAMVRNGDGTGSLKIIQPLDYEDPLQSSGFRFRIQV 450
            ..:|.|.|  |.......:..:..|      ::::.:...:|...:|||.|...:   :...|.|
Human   368 LFSVSDLDSGENGKISCSIQEDLPF------LLKSAENFYTLLTERPLDRESRAE---YNITITV 423

  Fly   451 NDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILEQFKATDADQG 515
            .|.|       ....:....:.|.:.|:|||.|.|.:....:.:.|:......:....|||.|.|
Human   424 TDLG-------TPMLITQLNMTVLIADVNDNAPAFTQTSYTLFVRENNSPALHIRSVSATDRDSG 481

  Fly   516 GHSKVAYKIVR------------STNRKRQFAISDRGAVSIQRPLDRETQDRHHIQILAIDDGSP 568
            .:::|.|.::.            |.|       :|.|.:...|.||.|.......::.|.|.|||
Human   482 TNAQVTYSLLPPQDPHLPLTSLVSIN-------ADNGHLFALRSLDYEALQGFQFRVGASDHGSP 539

  Fly   569 ARTATATLTVIVKDVNDNAPTF----------AQDYKPTLPENVSGKKILEVAAKDPDDRLRGNG 623
            |.::.|.:.|:|.|.|||:|..          ..:..|...|  .|..:.:|.|.|.|.   |..
Human   540 ALSSEALVRVVVLDANDNSPFVLYPLQNGSAPCTELVPRAAE--PGYLVTKVVAVDGDS---GQN 599

  Fly   624 GPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIISSLRPFDREAQKSYAIPIEIKDNGAPAMT 688
            ...:::|  |.:.|:  |....:...|:... ..::|     :|:|.| :.:.:.:||||.|..:
Human   600 AWLSYQL--LKATEL--GLFGVWAHNGEVRT-ARLLS-----ERDAAK-HRLVVLVKDNGEPPRS 653

  Fly   689 GTSTLTVTIGD 699
            .|:||.|.:.|
Human   654 ATATLHVLLVD 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 24/104 (23%)
Cadherin_repeat 140..248 CDD:206637 27/115 (23%)
Cadherin_repeat 256..359 CDD:206637 32/102 (31%)
Cadherin_repeat 379..481 CDD:206637 20/103 (19%)
Cadherin_repeat 489..586 CDD:206637 27/108 (25%)
Cadherin_repeat 594..703 CDD:206637 27/106 (25%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
PCDHB13NP_061756.1 Cadherin_2 31..112 CDD:285466 20/89 (22%)
Cadherin_repeat 141..239 CDD:206637 27/109 (25%)
Cadherin_repeat 248..344 CDD:206637 33/102 (32%)
Cadherin_repeat 357..447 CDD:206637 21/109 (19%)
Cadherin_repeat 455..557 CDD:206637 27/108 (25%)
Cadherin_repeat 576..664 CDD:206637 26/103 (25%)
Cadherin_C_2 686..768 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.