DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and PCDHGA10

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_061736.1 Gene:PCDHGA10 / 56106 HGNCID:8697 Length:936 Species:Homo sapiens


Alignment Length:677 Identity:176/677 - (25%)
Similarity:275/677 - (40%) Gaps:141/677 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDINRTTGDIFVLKPLDRDQ---PNGRPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQFP 253
            |.:|..:|.:.....:||::   .:.|....|.:..:|.     |....|::.:.|||||||:|.
Human    79 FSLNPRSGSLITAGRIDREELCAQSARCVVSFNILVEDR-----VKLFGIEIEVTDINDNAPKFQ 138

  Fly   254 QGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKN------VIEEETGAPIFEIEP 312
            .......:.||..||.......|:   ||:...|:...|.:..|      |.....|....|:..
Human   139 AENLDVKINENVAAGMRFPLPEAI---DPDVGVNSLQSYQLSPNKHFSLRVQSRANGVKYPELVL 200

  Fly   313 ETGLIKTAVCCLDRERTPDYSIQVVAMDGGG--LKGTGTASIRVKDLNDMPPQFTKDEWVTEVDE 375
            |..        ||||....:.:.:.|.|||.  ..||...|:.|.|.||..|.||..|:...|.|
Human   201 EHS--------LDREEEAIHHLVLTASDGGDPLRSGTVLVSVTVFDANDNAPVFTLPEYRVSVPE 257

  Fly   376 TNGTYIP-ETPILTVTVQDEDE-TN---TFQYKVVPNS---GFGADKFAMVRNGDGTGSLKIIQP 432
            .    :| .|.:||||..|.|| .|   |:.::.:|::   .|..:|:        ||.:||.:.
Human   258 N----LPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNKY--------TGEIKISEN 310

  Fly   433 LDYEDPLQSSGF-RFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYE 496
            ||||:    :|| ...||..|      ||:   ::|.:.|::.:.|:|||.|:.....:...:.|
Human   311 LDYEE----TGFYEIEIQAED------GGA---YLATAKVLITVEDVNDNSPELTITSLFSPVTE 362

  Fly   497 DTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRGAVSIQRPLDRETQDRHHIQIL 561
            |:.:||::......|.|...:.:|...|:.....|.:.:|.....:.|.|.||||....::|.:.
Human   363 DSPLGTVVALLNVHDLDSEQNGQVTCSILAYLPFKLEKSIDSYYRLVIHRALDREQVSSYNITVT 427

  Fly   562 AIDDGSPARTATATLTVIVKDVNDNAPTFAQ-DYKPTLPE-NVSGKKILEVAAKDPDDRLRGNGG 624
            |.|.|||..:..|...:.|.|:|||.|||:| .|...:|| |..|..|..|.|.|||.       
Human   428 ATDGGSPPLSTEAHFMLQVADINDNPPTFSQVSYFTYIPENNARGASIFSVTALDPDS------- 485

  Fly   625 PFTFRLDPLASDEIKAGFKVEYDRRGDNENGV------------AIISSLRPFDREAQKSYAIPI 677
                          |...::.|....|...||            .::.:||.||.|......:.:
Human   486 --------------KENAQIIYSLAEDTIQGVPLSSYISINSDTGVLYALRSFDYEQFHELQMQV 536

  Fly   678 EIKDNGAPAMTGTSTLTVTIGDVNDN----------------------KMQPG---SKSVLVYNY 717
            ...|:|.|.::...:|::.:.|.|||                      ..:||   :|.|.|...
Human   537 TASDSGDPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRD 601

  Fly   718 QGQSQDTPIGRVYVNDPDDWDVPDKKYYWEVQEHQRFKLDTDTG-ILTMRAGTRRGRYQLRFKVY 781
            .||:.......:..::|.         .:.|.||        || :.|.||...|...:....|.
Human   602 SGQNAWLSYRLLKASEPG---------LFAVGEH--------TGEVRTARALLDRDALKQSLVVA 649

  Fly   782 DREHGQEDIPANLSVTVRDITAEAVQQ 808
            .::|||..:.|.:::||  ..|:::.|
Human   650 VQDHGQPPLSATVTLTV--AVADSIPQ 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 13/58 (22%)
Cadherin_repeat 256..359 CDD:206637 27/110 (25%)
Cadherin_repeat 379..481 CDD:206637 33/110 (30%)
Cadherin_repeat 489..586 CDD:206637 26/96 (27%)
Cadherin_repeat 594..703 CDD:206637 27/121 (22%)
Cadherin_repeat 724..801 CDD:206637 17/77 (22%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
PCDHGA10NP_061736.1 Cadherin_2 34..116 CDD:285466 7/36 (19%)
Cadherin_repeat 144..242 CDD:206637 28/108 (26%)
Cadherin_repeat 250..347 CDD:206637 36/121 (30%)
Cadherin_repeat 360..452 CDD:206637 26/91 (29%)
Cadherin_repeat 460..562 CDD:206637 27/122 (22%)
Cadherin_repeat 583..670 CDD:206637 24/105 (23%)
Cadherin_C_2 692..776 CDD:293101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 806..845
Cadherin_tail 813..>909 CDD:292596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 906..936
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.