DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and PCDHGB7

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_061750.1 Gene:PCDHGB7 / 56099 HGNCID:8714 Length:929 Species:Homo sapiens


Alignment Length:652 Identity:179/652 - (27%)
Similarity:294/652 - (45%) Gaps:65/652 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDINRTTGDIFVLKPLDRDQ---PNGRPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQFP 253
            |.::..:||:.|...:||:|   ...|.:.:.....     |..:....:.|.::|:||:||||.
Human    75 FSVDAQSGDLLVKDRIDREQICKERRRCELQLEAVV-----ENPLNIFHVIVVIEDVNDHAPQFR 134

  Fly   254 QGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKN----VIEEETGAPIFEIEPET 314
            :......::|:.:.|...:..||   :||:.|.|:...|.:..|    ::|::.  |.....||.
Human   135 KDEINLEISESVSLGMGTILESA---EDPDISMNSLSKYQLSPNEYFSLVEKDN--PDGGKYPEL 194

  Fly   315 GLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIR--VKDLNDMPPQFTKDEWVTEVDETN 377
            .|.||    ||||....:.:.:.|:|||....:|||.||  |.|.||.||.|::|.:...:.|  
Human   195 VLQKT----LDRETQSAHHLVLTALDGGDPPRSGTAQIRILVIDANDNPPVFSQDVYRVSLRE-- 253

  Fly   378 GTYIPETPILTVTVQDEDETNTFQYKVVPNSGFG-ADKFAMVRNGD-GTGSLKIIQPLDYEDPLQ 440
             ...|.|.||.|...|:||....:   :..|.|| |||...|.:.| .||::...||||:|   :
Human   254 -DVPPGTSILRVKATDQDEGINSE---ITYSFFGVADKAQHVFSLDYTTGNILTQQPLDFE---E 311

  Fly   441 SSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILE 505
            ...:...|:..|:|...         ....|:|::.|.|||.|:.....:...|.||:..|.::.
Human   312 VERYTINIEAKDRGSLS---------TRCKVIVEVVDENDNSPEIIITSLSDQIMEDSPPGVVVA 367

  Fly   506 QFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRGAVSIQRPLDRETQDRHHIQILAIDDGSPAR 570
            .||..|.|.|.:.:|...:.|....|...:.::...:.....||||....:::.|.|.|.|.|..
Human   368 LFKTRDQDSGENGEVRCSLSRGVPFKIHSSSNNYYKLVTDEALDREQTPEYNVTIAATDRGKPPL 432

  Fly   571 TATATLTVIVKDVNDNAPTFAQD-YKPTLPE-NVSGKKILEVAAKDPDDRLRGNGGPFTFRLDPL 633
            :::.|:|:.:.|||||||.|.|. |...:|| |..|..|.:|:|.|||..|.|... ::.....|
Human   433 SSSKTITLHITDVNDNAPVFGQSAYLVHVPENNQPGASIAQVSASDPDFGLNGRVS-YSLIASDL 496

  Fly   634 ASDEIKAGFKVEYDRRGDNENGVAIISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTIG 698
            .|..:.:...|      ..::||  :.:.|.||.|..:::.:.::.:|.|:||::...:|.|.:|
Human   497 ESRTLSSYVSV------SAQSGV--VFAQRAFDHEQLRTFELTLQARDQGSPALSANVSLRVLVG 553

  Fly   699 DVNDN-------KMQPGSKSVLVYNYQGQSQDTPIGRVYVNDPDDWDVPDKKYY-WEVQEHQRFK 755
            |.|||       .:.|...::.....:.......:.:|...|.|........|: .:..|...|.
Human   554 DRNDNAPRVLYPALGPDGSALFDTVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVVQASEPGLFS 618

  Fly   756 LDTDTGILTM-RAGTRRGRYQLRFKVYDREHGQEDIPANLSVTVRDITAEAVQQAGSMRLSHITD 819
            |...||.:.| ||...:...:.|..|..|:.||.  |.:.:.|:..:.|:::|:.......|.|.
Human   619 LGLRTGEVRMVRALGDKDSVRQRLLVAVRDGGQP--PLSATATLHLVFADSLQEVLPDFSDHPTP 681

  Fly   820 ED 821
            .|
Human   682 SD 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 12/58 (21%)
Cadherin_repeat 256..359 CDD:206637 32/108 (30%)
Cadherin_repeat 379..481 CDD:206637 30/103 (29%)
Cadherin_repeat 489..586 CDD:206637 26/96 (27%)
Cadherin_repeat 594..703 CDD:206637 31/109 (28%)
Cadherin_repeat 724..801 CDD:206637 19/78 (24%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
PCDHGB7NP_061750.1 Cadherin_2 32..112 CDD:285466 8/41 (20%)
Cadherin_repeat 137..238 CDD:206637 33/109 (30%)
Cadherin_repeat 246..343 CDD:206637 31/114 (27%)
Cadherin_repeat 355..448 CDD:206637 26/92 (28%)
Cadherin_repeat 457..558 CDD:206637 31/109 (28%)
Cadherin_repeat 577..662 CDD:206637 19/86 (22%)
Cadherin_C_2 687..767 CDD:293101
Cadherin_tail 806..>902 CDD:292596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 806..838
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 899..929
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.