DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and PCDHGC4

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_061751.1 Gene:PCDHGC4 / 56098 HGNCID:8717 Length:938 Species:Homo sapiens


Alignment Length:678 Identity:183/678 - (26%)
Similarity:282/678 - (41%) Gaps:125/678 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RYQITGGNIGNAFAVQNTTGVIYVASPLDYET----RPRYELRLEATRNRKNNYTTVVINVRDVN 130
            |.|:.|......|.|...:|.:.:.:|:|.|.    .....:.||.............:.:.|||
Human    63 RLQVAGEVNQRHFRVDLDSGALLIKNPIDREALCGLSASCIVPLEFVTEGPLEMYRAEVEIVDVN 127

  Fly   131 DNPPVFDRQTYRTQITEEDDRNLPKRILQVTATDGDVDRPINIVYFLTGQGIDPDNPANSKFDIN 195
            |:.|.|.||....:|.|.....  :|.....|.|.||.......|.|:         :|..|.::
Human   128 DHAPRFPRQQLDLEIGEAAPPG--QRFPLEKAQDADVGSNSISSYRLS---------SNEHFALD 181

  Fly   196 ---RTTG----DIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQFP 253
               |:.|    ::.:.|||||::   :..:|..:.|.|.|.....|.|:::|::.|:|||||.|.
Human   182 VKKRSDGSLVPELLLEKPLDREK---QSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAPAFQ 243

  Fly   254 QGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIE-----KNVIEEETGAPIFEIEPE 313
            |..|..:|.|:..||..::.::|.| .|...|.|....:|..     :|         :|.:.|.
Human   244 QSSYRISVLESAPAGMVLIQLNASD-PDLGPSGNVTFYFSGHTPDRVRN---------LFSLHPT 298

  Fly   314 TGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTASIRVK--DLNDMPPQFTKDEWVTEVDET 376
            ||.: |.:..||.|....|...|.|.|||........|:||.  |:||..|..|       |...
Human   299 TGKL-TLLGPLDFESENYYEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYIT-------VTSE 355

  Fly   377 NGTYIPE-----TPILTVTVQDEDETNTFQYKVVPNSGFGAD---------KFAMVRNGDGTGSL 427
            .|| :||     |.:..::|||            |:||...|         .||:........||
Human   356 LGT-LPESAEPGTVVALISVQD------------PDSGSNGDVSLRIPDHLPFALKSAFRNQFSL 407

  Fly   428 KIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEV 492
            ....|||.|   ..|.:...:..:|.|:  |..|     .:..:.:.:.|:|||.|.|.:...||
Human   408 VTAGPLDRE---AKSSYDIMVTASDAGN--PPLS-----THRTIFLNISDVNDNPPSFFQRSHEV 462

  Fly   493 SIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNR--KRQFAIS---DRGAVSIQRPLDRET 552
            .:.|:.:.|.:|....|:|.|.|.::.::|.::...||  .....||   ..|||...|..|.|.
Human   463 FVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQ 527

  Fly   553 QDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQD-YKP------TLPENV-SGKKILE 609
            ......::.|.|.|:|..::|.|:.:.|.|:|||||...:. .:|      .||.:| :|..|.:
Human   528 TQTLQFEVQARDRGNPPLSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITK 592

  Fly   610 VAAKDPDDRLRGNGGPFTFRL----DPLASDEIKAGFKV-EYDRRGDNENGVAIISSLRPFDREA 669
            |.|.|.|.   |.....:::|    ||       :.|.| .|  .|:....|.|     |.|...
Human   593 VTAVDLDS---GYNAWVSYQLLEAPDP-------SLFAVSRY--AGEVRTAVPI-----PADLPP 640

  Fly   670 QKSYAIPIEIKDNGAPAMTGTSTLTVTI 697
            ||   :.|.:||:|:|.::.:.||.|::
Human   641 QK---LVIVVKDSGSPPLSTSVTLLVSL 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 14/65 (22%)
Cadherin_repeat 140..248 CDD:206637 27/114 (24%)
Cadherin_repeat 256..359 CDD:206637 30/109 (28%)
Cadherin_repeat 379..481 CDD:206637 26/115 (23%)
Cadherin_repeat 489..586 CDD:206637 29/101 (29%)
Cadherin_repeat 594..703 CDD:206637 32/116 (28%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
PCDHGC4NP_061751.1 Cadherin_repeat 246..346 CDD:206637 31/110 (28%)
Cadherin_repeat 358..451 CDD:206637 26/115 (23%)
Cadherin_repeat 461..561 CDD:206637 29/99 (29%)
Cadherin_repeat 580..666 CDD:206637 31/106 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..847
Cadherin_tail 817..>911 CDD:374265
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 908..938
Cadherin_2 30..111 CDD:369785 11/47 (23%)
Cadherin_repeat 140..238 CDD:206637 27/111 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.