DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and AKIRIN2

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_060534.1 Gene:AKIRIN2 / 55122 HGNCID:21407 Length:203 Species:Homo sapiens


Alignment Length:133 Identity:26/133 - (19%)
Similarity:54/133 - (40%) Gaps:26/133 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1568 VLYSRKRKTTKKKKRSGPEKDVRETVISYEDEGGGEDDMTAFDITPLQIPISAQGGPPDIAACKM 1632
            :||:.|::..:.:||...|...::|           |.....|..|....:|....|...:|...
Human    81 ILYNIKQEYKRMQKRRHLETSFQQT-----------DPCCTSDAQPHAFLLSGPASPGTSSAASS 134

  Fly  1633 PI--IYPVMTLLPPGQELNVAYLMEERKQRIDKDNNAPPFDDLRNFTFEGSGSIAESLSSLASGT 1695
            |:  ..|:.||...|  :....|::||::::.::     ::::.|      ..:||...:....|
Human   135 PLKKEQPLFTLRQVG--MICERLLKEREEKVREE-----YEEILN------TKLAEQYDAFVKFT 186

  Fly  1696 DDE 1698
            .|:
Human   187 HDQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637
Cadherin_repeat 256..359 CDD:206637
Cadherin_repeat 379..481 CDD:206637
Cadherin_repeat 489..586 CDD:206637
Cadherin_repeat 594..703 CDD:206637
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398 21/118 (18%)
AKIRIN2NP_060534.1 akirin-2 2..203 CDD:412036 26/133 (20%)
Nuclear localization signal 22..27
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.