DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and Cdh24

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:XP_008768930.1 Gene:Cdh24 / 498515 RGDID:1560161 Length:781 Species:Rattus norvegicus


Alignment Length:579 Identity:171/579 - (29%)
Similarity:285/579 - (49%) Gaps:73/579 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PKRILQVTATDGDVDR-PINIVYFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQ 217
            |:.:| :.....|||| .....|.|||:|      |.:.|.|:..||:|.|.|.|||::   :.|
  Rat    60 PEPVL-IGKLHSDVDRGEGRTKYLLTGEG------AGTVFVIDEATGNIHVTKSLDREE---KAQ 114

  Fly   218 WRFTVFAQDE-GGEGLVGYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDD 281
            :.....|.|. ....|...::..:.::|||||.|.||.|.|...|.|....|:||:.::|.|.||
  Rat   115 YVLLAQAVDRASNRPLEPPSEFIIKVQDINDNPPVFPLGPYHATVPEMSNVGTSVIQVTAHDADD 179

  Fly   282 PNESTNAKLIYSIEKNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMD----GG 342
            |:...:|||:|::       ..|.|.|.::|:||:::||:..:|||...::.:.:.|.|    .|
  Rat   180 PSYGNSAKLVYTV-------LDGLPFFSVDPQTGVVRTAIPNMDRETQEEFLVVIQAKDMGGHMG 237

  Fly   343 GLKGTGTASIRVKDLNDMPPQFTKDEWVTEVDETNGTYIPETPILTVTVQDED--ETNTFQYKVV 405
            ||.|:.|.::.:.|:||.||:|.:..:...|.||.|   |.|.:..:..||.|  :.....|.::
  Rat   238 GLSGSTTVTVTLSDVNDNPPKFPQSLYQFSVVETAG---PGTLVGRLKAQDPDLGDNALMAYSIL 299

  Fly   406 PNSGFGADKFAMVRNGDG-TGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDD------GPGGSDK 463
              .|.|::.|::..:..| .|.|.:.:|||:|   ....:.||::..:...|      ||     
  Rat   300 --DGEGSEAFSISTDSQGQDGLLTVRKPLDFE---TRRSYTFRVEATNTLIDPAYLRRGP----- 354

  Fly   464 YHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRST 528
             ....:.|.|.::|..: .|.|.:....:.:.|:...||::.|..|.|.|... |.:.|.|:..:
  Rat   355 -FKDVASVRVAVQDAPE-PPAFTQATYHLVVPENKAPGTLVGQISANDLDSPA-SPIRYSILPHS 416

  Fly   529 NRKRQFAIS-DRGAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQ 592
            :.:..|:|. :.|.:.....||||.:..:::.:||.:..|.|:::...:.:...|.|||||..|:
  Rat   417 DPEHCFSIEPEDGTIRTAVRLDREARVWYNLTVLATELDSSAQSSRVQVAIQTLDENDNAPQLAE 481

  Fly   593 DYKPTLPENVS-GKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGV 656
            .|...:.::.: |:.|..:.|.|.|:  .||....:.: .|:..|   |.|.|.     ||.:|.
  Rat   482 PYDLFVCDSAAPGQLIQVIRALDRDE--VGNSSQVSLQ-GPVGPD---ANFTVR-----DNRDGS 535

  Fly   657 AIISSLRPFDREA---QKSYAIPIEIKDNGAPAMTGTSTLTVTIGDVNDNKMQP-GSKS 711
            |  |.|.| .|.|   |..|.:|||:.|.|.||::.|:|:||::     .:.|| ||::
  Rat   536 A--SLLLP-SRPAPPRQAPYLVPIELWDWGQPALSSTATVTVSV-----CRCQPDGSRA 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 29/95 (31%)
Cadherin_repeat 256..359 CDD:206637 34/106 (32%)
Cadherin_repeat 379..481 CDD:206637 24/110 (22%)
Cadherin_repeat 489..586 CDD:206637 23/97 (24%)
Cadherin_repeat 594..703 CDD:206637 35/112 (31%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Cdh24XP_008768930.1 CA 70..148 CDD:214520 29/86 (34%)
Cadherin_repeat 154..255 CDD:206637 35/107 (33%)
Cadherin_repeat 264..368 CDD:206637 27/117 (23%)
Cadherin_repeat 378..475 CDD:206637 23/97 (24%)
Cadherin 483..577 CDD:421759 35/112 (31%)
Cadherin_C 625..776 CDD:395833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5067
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24027
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.