DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and pcdh2ab7

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001009594.1 Gene:pcdh2ab7 / 493593 ZFINID:ZDB-GENE-041118-6 Length:939 Species:Danio rerio


Alignment Length:697 Identity:187/697 - (26%)
Similarity:298/697 - (42%) Gaps:156/697 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 YQITGGNIGNAFAVQNTTGVIYVASPLDYE----TRPRYELRLEATRNRKNNYTTVVINVRDVND 131
            :||.|.| ...|.|...||::.|...||.|    ...:..|.|||..|...|.....:||.|:||
Zfish    62 FQIVGPN-KRYFDVNMKTGILQVKDKLDREEICGQSLKCALELEAIVNSPLNMYRFEVNVLDIND 125

  Fly   132 NPPVFDRQTYRTQITEE----DDRNLPKRILQVTATDGDVDRPINIV--YFLTGQGIDPDNPANS 190
            |.|.|...:.:..::|.    :..:||      :|.|.||.  ||.|  |.|:         ||.
Zfish   126 NSPTFHSSSLQLNVSEAAFIGERYSLP------SADDADVG--INSVKSYKLS---------ANE 173

  Fly   191 KFDINRTTG-------DIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDN 248
            .|.::..:|       ::.:.|.|||::   :|..|.|:.|.|.|.....|..:|.|.:.|.|||
Zfish   174 HFSLDVQSGGEQSVSAELVLQKALDREK---QPVIRLTLTAVDGGKPARSGTVNIIVKIIDANDN 235

  Fly   249 APQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKN----VIEEETGAPIFE 309
            .|.|.:.:|...:.||...|:|::|::|.|.|   |..|.::.||..|:    :||.      |.
Zfish   236 IPVFTKSLYKARIPENAPVGTSIITVNARDAD---EGLNGEIEYSFIKHKNDRIIES------FA 291

  Fly   310 IEPETGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTAS--IRVKDLNDMPPQFTKDEWVTE 372
            |...:|.| |.:..||.|......|:|.|.|.|.|.......  |.:.|:||..|:.:....|..
Zfish   292 INEVSGEI-TVLGKLDHESNNAVEIRVQARDKGSLPRAAHCKVLIEIMDVNDNIPEISVTSLVNV 355

  Fly   373 VDETNGTYIPE-TPILTVTVQDED--ETNTFQYKVVPNSGFG-----ADKFAMVRNGDGTGSLKI 429
            |:|.:    |: |.:..|||:|:|  |..:.:.|::.:..|.     .:|:::|.:|        
Zfish   356 VNEDS----PKGTMVGLVTVKDDDSGENGSVKLKILDSLPFALQNTYKNKYSLVVDG-------- 408

  Fly   430 IQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSI 494
              |||.|   ::|.:...|...|:|.. |..|.      |.:.|.:.|:|||.|:|....|.|.:
Zfish   409 --PLDRE---RASEYNVTISAADEGSP-PLSST------SVIAVHVSDVNDNAPRFPEPVINVYV 461

  Fly   495 YEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRGAVSIQRPLDRETQDRHHIQ 559
            .|::::|.:|....|.|.|.|.::::.|.::.|         |..|.|:....::.:|.|.|.:|
Zfish   462 KENSQIGAVLHTVSAVDPDVGDNARITYSLLES---------SKSGPVTSMININSDTGDLHSLQ 517

  Fly   560 -------------ILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDYK---PTLPENV-----S 603
                         :.|.|.|.|..::..|:.|.|.|.|||:|.....|.   ....||:     :
Zfish   518 SFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEA 582

  Fly   604 GKKILEVAAKDPD-----------DRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVA 657
            |..:.::.|.|.|           ...:||.   .||:. .:|.||:.     ..|..||:    
Zfish   583 GYFVAKIRAVDADSGYNALLSYHISEPKGNN---LFRIG-TSSGEIRT-----KRRMSDND---- 634

  Fly   658 IISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTI----GDV 700
                        .|::.:.|.:.|||.|:::.|.::...:    |||
Zfish   635 ------------LKTHPLVILVCDNGEPSLSATVSIDAVVVESGGDV 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 22/64 (34%)
Cadherin_repeat 140..248 CDD:206637 31/120 (26%)
Cadherin_repeat 256..359 CDD:206637 32/108 (30%)
Cadherin_repeat 379..481 CDD:206637 27/109 (25%)
Cadherin_repeat 489..586 CDD:206637 27/109 (25%)
Cadherin_repeat 594..703 CDD:206637 27/130 (21%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
pcdh2ab7NP_001009594.1 Cadherin_2 28..108 CDD:285466 16/46 (35%)
Cadherin_repeat 134..235 CDD:206637 31/120 (26%)
Cadherin_repeat 244..343 CDD:206637 33/108 (31%)
Cadherin_repeat 356..448 CDD:206637 29/115 (25%)
Cadherin_repeat 456..557 CDD:206637 27/109 (25%)
Cadherin_repeat 575..658 CDD:206637 22/107 (21%)
Cadherin_C_2 685..757 CDD:293101
Cadherin_tail 793..911 CDD:292596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.