DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and Dchs1

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:XP_006507718.1 Gene:Dchs1 / 233651 MGIID:2685011 Length:3431 Species:Mus musculus


Alignment Length:827 Identity:227/827 - (27%)
Similarity:375/827 - (45%) Gaps:112/827 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IADKNDSPPYFDRFLYETE-IDENADLQSTVLTVNAKDHNESTN--IRYQITGGNIGNAFAVQNT 87
            :.|.||:.|.|||.||..| :.|.|...|.|:.|.|:|.::.||  |.|.:..|...:.|::..|
Mouse   596 VTDVNDNAPAFDRQLYRPEPLPEVALPGSFVVRVTARDPDQGTNGQITYSLAPGTHTHWFSIDPT 660

  Fly    88 TGVIYVASPLDYETRPRYELRLEATRNRKN---NYTTVVINVRDVNDNPPVFDRQTYRTQITEED 149
            :|:|..|:.||||..|:.:|.:.||.....   :..||.:.::|||||.|.|.|..|...:.|..
Mouse   661 SGIITTAATLDYELEPQPQLIVVATDGGLPPLVSSATVSVALQDVNDNEPQFQRTFYNASLPEGT 725

  Fly   150 DRNLPKRILQVTATDGDVDRPINIVYFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNG 214
            ...  ...|||||||.| ..|..::.:..|.|:...  .:..|.|:..:||:...:.|||||  |
Mouse   726 QPG--TCFLQVTATDAD-SGPFGLLSYSLGAGLGAS--GSPPFRIDAHSGDVCTTRTLDRDQ--G 783

  Fly   215 RPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDY 279
            ...:.|||.|.|  |.||.....::|.:.|.|||.|||....|..:::...|.|::|:.:.|   
Mouse   784 PSSFDFTVTAID--GGGLKSMVYVKVFVADENDNPPQFYPREYAASLSAQSTPGTAVLRVHA--- 843

  Fly   280 DDPNESTNAKLIYSIEKNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMDGGGL 344
            .||::..:.:|.|.|...     ...|:|.::..:||: |....|.|.......:::.|.|||||
Mouse   844 HDPDQGPHGRLSYHILAG-----NSPPLFALDAHSGLL-TVAWPLGRRANSVVQLEIGAQDGGGL 902

  Fly   345 KGTGTASIRVKDL--NDMPPQFTKDEWVTEVDETNGTYIPETPI--------------LTVTVQD 393
            :....|.:.:..:  ...||.|.:.::|..|.|   ...|.|.:              :|:|:..
Mouse   903 QAEPIARVNISIVPGTPTPPIFEQLQYVFSVPE---DVAPGTSVGIIQAHNPPGRLGPVTLTLSG 964

  Fly   394 EDETNTFQYKVVPNSGFGADKFAMVRNGDGTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGP 458
            .|          |...|..|        ..:|.||.::|||.|  |........::.      |.
Mouse   965 GD----------PRGLFSLD--------SPSGLLKTLRPLDRE--LLGPVLELEVRA------GS 1003

  Fly   459 GGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYK 523
            |....:.||.  :.|.|.|:|||.|.|......|.:.::|..||.:...:|.|.|.|.:|::.:.
Mouse  1004 GTPPVFAVAR--IRVLLDDVNDNSPAFPAPEDTVLLPQNTAPGTPIYTLRALDPDSGANSRITFN 1066

  Fly   524 IVRSTNRKRQFAIS-DRGAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKD--VND 585
            ::...:  ..|.:. ..|.|.:..||.......|.:::.|.|.|||.||:...|.|:::|  ::.
Mouse  1067 LLAGGD--GLFTVDPTTGHVRLMGPLGPPGGPAHELEVEARDGGSPPRTSHFRLRVVIQDLGIHG 1129

  Fly   586 NAPTF-AQDYKPTLPE-NVSGKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDR 648
            .||.| :..|:..||. ..:|.:||:|.|:.||      |.|.|:.   ||:|...:.|.:|   
Mouse  1130 LAPRFDSPTYRVDLPSGTTTGTQILQVQAQAPD------GSPVTYH---LAADGASSPFGLE--- 1182

  Fly   649 RGDNENGVAIISSLRPFDREAQKSYAIPIEIKDNGAPA----MTGTSTLTVTIGDVNDNKMQPGS 709
               :::|...:.:  ..|||:|:.|.:.: :..:|:.|    .|||:|:.|.|.:.||:..:...
Mouse  1183 ---SQSGWLWVRT--ALDRESQELYTLKV-MAVSGSKAELGQQTGTATVRVIILNQNDHSPRLSE 1241

  Fly   710 KSVLVYNYQGQSQDTPIGRVYVNDPDDWDVPDKKYYWEVQ----EHQRFKLDTDTG-ILTMRAGT 769
            :...:...:.|...|.:|||:..|.|..  |:.:..:.:|    :.:.|::...|| :.|::...
Mouse  1242 EPTFLAVAENQPPGTSVGRVFATDRDSG--PNGRLTYSLQQLSEDSKAFRIHPQTGEVTTLQTLD 1304

  Fly   770 R--RGRYQLRFKVYDREHGQEDIPANLSVTVRDITAEA---VQQAGS 811
            |  :..:||..:|.|...........:.|.|.|:...:   :|.:|:
Mouse  1305 REQQSSFQLLVQVQDGGSPPRSATGTVHVAVLDLNDNSPTFLQASGA 1351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 32/96 (33%)
Cadherin_repeat 140..248 CDD:206637 34/107 (32%)
Cadherin_repeat 256..359 CDD:206637 24/104 (23%)
Cadherin_repeat 379..481 CDD:206637 24/115 (21%)
Cadherin_repeat 489..586 CDD:206637 25/99 (25%)
Cadherin_repeat 594..703 CDD:206637 33/113 (29%)
Cadherin_repeat 724..801 CDD:206637 19/83 (23%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Dchs1XP_006507718.1 Cadherin_repeat 183..273 CDD:206637
Cadherin_repeat 284..385 CDD:206637
Cadherin_repeat 394..492 CDD:206637
Cadherin_repeat 508..602 CDD:206637 2/5 (40%)
Cadherin_repeat 616..708 CDD:206637 30/91 (33%)
Cadherin_repeat 717..815 CDD:206637 34/106 (32%)
Cadherin_repeat 823..915 CDD:206637 24/100 (24%)
Cadherin_repeat 928..1024 CDD:206637 27/126 (21%)
Cadherin_repeat 1034..1124 CDD:206637 24/91 (26%)
Cadherin_repeat 1138..1235 CDD:206637 33/114 (29%)
Cadherin_repeat 1248..1341 CDD:206637 21/94 (22%)
Cadherin_repeat 1358..1446 CDD:206637
Cadherin_repeat 1469..1565 CDD:206637
Cadherin_repeat 1578..1675 CDD:206637
Cadherin_repeat 1684..1777 CDD:206637
Cadherin_repeat 1786..1880 CDD:206637
Cadherin_repeat 1890..1984 CDD:206637
Cadherin_repeat 1992..2089 CDD:206637
Cadherin_repeat 2116..2192 CDD:206637
Cadherin_repeat 2207..2300 CDD:206637
Cadherin_repeat 2308..2406 CDD:206637
Cadherin_repeat 2415..2505 CDD:206637
Cadherin_repeat 2514..2611 CDD:206637
Cadherin_repeat 2619..2731 CDD:206637
Cadherin_repeat 2739..2835 CDD:206637
Cadherin_repeat 2845..2941 CDD:206637
Cadherin_repeat 2950..3056 CDD:206637
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9B2
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100175
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.