DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and Cdh19

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001074855.1 Gene:Cdh19 / 227485 MGIID:3588198 Length:770 Species:Mus musculus


Alignment Length:546 Identity:149/546 - (27%)
Similarity:262/546 - (47%) Gaps:62/546 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DPDNPANS-----------KFDINRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQ---DEGGEGLV 233
            |.||..||           .|.||..||:|..::.|||::.:     .:.:.||   ...|:.:.
Mouse    68 DLDNGNNSFQYKLLGIGAGSFSINERTGEICAIQKLDREEKS-----LYILRAQVIDTTIGKAVE 127

  Fly   234 GYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNV 298
            ..::..:.:.|||||.|:|....|...|.|....|:.|:.::|.|.|||:...:|:::|::|:  
Mouse   128 TESEFVIRVLDINDN
EPRFLDEPYEAIVPEMSPEGTFVIKVTANDADDPSTGYHARILYNLER-- 190

  Fly   299 IEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMD----GGGLKGTGTASIRVKDLND 359
                 |.|.|.:||.||:|:.: ..:|||....|.:.:.|.|    .|.|.||.|.||::.|:||
Mouse   191 -----GQPYFSVEPTTGVIRIS-SKMDRELQDTYCVIIQAKDMLGQPGALSGTTTVSIKLSDIND 249

  Fly   360 MPPQFTKDEWVTEVDETN--GTYIPETPILTVTVQDED--ETNTFQYKVVPNSGFGADKFAMVRN 420
            ..|.|.:..:...:.|:.  ||.|.:     :...|:|  |....:|.:..:.....|  .::.|
Mouse   250 NKPIFKESFYRFTISESAPIGTSIGK-----IMAYDDDIGENAEMEYSIEDDDSKIFD--IIIDN 307

  Fly   421 GDGTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKF 485
            ....|.:.:.:.:|:|   |.|.:..|.:|.:...|........:.:.:::.|::.| .|..|.|
Mouse   308 DTQEGIVILKKKVDFE---QQSYYGIRAKVKNCHVDEELAPAHVNASTTYIKVQVED-EDEPPVF 368

  Fly   486 DREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRGAVSIQRPLDR 550
            ...:..:.|.|....|||:....|||.|: ..|.:.|.:..|    :.|.|:|.|.:.....|||
Mouse   369 LLPYYILEIPEGKPYGTIVGTVSATDPDR-RQSPMRYYLTGS----KMFDINDNGTIITTNMLDR 428

  Fly   551 ETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDYKPTLPENV-SGKKILEVAAKD 614
            |....:::.:.|.:..:..:.::|.:.|.|.::|||||.|:|.|:..:.||. ||:.:..::|.|
Mouse   429 EVSAWYNLTVTATETYNVQQISSAHVYVQVFNINDNAPEFSQFYETYVCENAESGEIVQIISAID 493

  Fly   615 PDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIISSLRP-FDREAQKSYAIPIE 678
            .|:.:..:...|...|:    |...:.|.:.     ||::..|:|.|.|. |:.:.:..:.:.|.
Mouse   494 RDESIEDHHFYFNHSLE----DTNNSSFMLT-----DNQDNTAVILSNRTGFNLKEEPVFYMIIL 549

  Fly   679 IKDNGAPAMTGTSTLTVTIGDVNDNK 704
            |.|||.|::|.|:|||:.:.|..|::
Mouse   550 IADNGIPSLTSTNTLTIQVCDCGDSR 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 20/78 (26%)
Cadherin_repeat 256..359 CDD:206637 35/106 (33%)
Cadherin_repeat 379..481 CDD:206637 18/103 (17%)
Cadherin_repeat 489..586 CDD:206637 25/96 (26%)
Cadherin_repeat 594..703 CDD:206637 31/110 (28%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Cdh19NP_001074855.1 Cadherin_repeat 50..142 CDD:206637 20/78 (26%)
Cadherin_repeat 150..250 CDD:206637 36/107 (34%)
Cadherin_repeat 259..364 CDD:206637 20/115 (17%)
Cadherin_repeat 373..464 CDD:206637 25/95 (26%)
Cadherin_repeat 472..570 CDD:206637 30/106 (28%)
Cadherin_C 617..764 CDD:395833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5176
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.