DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and DSC3

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001932.2 Gene:DSC3 / 1825 HGNCID:3037 Length:896 Species:Homo sapiens


Alignment Length:667 Identity:178/667 - (26%)
Similarity:292/667 - (43%) Gaps:136/667 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FAVQNTTGVIYVASPLDYETRPR-YELRLEATRNRKNNYTTVVINVRDVNDNPPVFDRQTYRTQI 145
            |.|.| .|.:|.|..:....:.| :.:.|...|.:.....||::.          ..::..:|:.
Human    71 FRVLN-DGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTV
LLE----------HQKKVSKTRH 124

  Fly   146 TEE-----------------DDRNLPKRILQVTATDGDVDRPINIVYFLTGQGIDPDNPANSKFD 193
            |.|                 .:.:|....|.:...:.|..:...:.|.::|:|:|.: |.| .|.
Human   125 TRETVLRRAKRRWAPIPCSMQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKE-PLN-LFY 187

  Fly   194 INRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYAD------------IQVNLKDIN 246
            |.|.||::|..:|:||::        :.||       .|:.||.            :.:.::|.|
Human   188 IERDTGNLFCTRPVDREE--------YDVF-------DLIAYASTADGYSADLPLPLPIRVEDEN 237

  Fly   247 DNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIEEETGAP-IFEI 310
            ||.|.|.:.||...|.|:...|::|..:.|.|.|:| ::.:.:|.|||    :::...:| :|.:
Human   238 DNHPVFTEAIYNFEVLESSRPGTTVGVVCATDRDEP-DTMHTRLKYSI----LQQTPRSPGLFSV 297

  Fly   311 EPETGLIKTAVCCLDRERTPDYSI--QVVAMDGG--GLKGTGTASIRVKDLNDMPPQFTKDEWVT 371
            .|.||:|.|....||||....||:  :|..|||.  ||.||.|..|.|.|.||..|.|.::.:..
Human   298 HPSTGVITTVSHYLDREVVDKYSLIMKVQDMDGQFFGLIGTSTCIITVTDSNDNAPTFRQNAYEA 362

  Fly   372 EVDETNGTYIPETPILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRNGD------------GT 424
            .|:| |...:   .||.:.::|:|..||..::|         .|.:::..:            ..
Human   363 FVEE-NAFNV---EILRIPIEDKDLINTANWRV---------NFTILKGNENGHFKISTDKETNE 414

  Fly   425 GSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVA---YSWVVVKLRDINDNVPKFD 486
            |.|.:::||:||:..|   ....|.||   ::.|...|...|.   .:.|.|.:||: |..|:..
Human   415 GVLSVVKPLNYEENRQ---VNLEIGVN---NEAPFARDIPRVTALNRALVTVHVRDL-DEGPECT 472

  Fly   487 REHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISD-RGAVSIQRPLDR 550
            .....|.|.|:..||:.:..:||.|.:....:.:.||  :..:.|....|.: .|::...:.|||
Human   473 PAAQYVRIKENLAVGSKINGYKAYDPENRNGNGLRYK--KLHDPKGWITIDEISGSIITSKILDR 535

  Fly   551 ETQ----DRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDY----KPTLPENVSGKKI 607
            |.:    :.::|.:||||...  |:.|.||.|.::|||||.|...|:|    ||.:       ..
Human   536 EVETPKNELYNITVLAIDKDD--RSCTGTLAVNIEDVNDNPPEILQEYVVICKPKM-------GY 591

  Fly   608 LEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIISSLRPFDREAQ-K 671
            .::.|.|||:.:  :|.||.|.| |..|.||...:.:      ...|..|...|   :.:.|. :
Human   592 TDILAVDPDEPV--HGAPFYFSL-PNTSPEISRLWSL------TKVNDTAARLS---YQKNAGFQ 644

  Fly   672 SYAIPIEIKDNGAPAMT 688
            .|.|||.:||....|.|
Human   645 EYTIPITVKDRAGQAAT 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 11/50 (22%)
Cadherin_repeat 140..248 CDD:206637 28/136 (21%)
Cadherin_repeat 256..359 CDD:206637 39/107 (36%)
Cadherin_repeat 379..481 CDD:206637 25/116 (22%)
Cadherin_repeat 489..586 CDD:206637 30/101 (30%)
Cadherin_repeat 594..703 CDD:206637 28/100 (28%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
DSC3NP_001932.2 Cadherin_pro 27..111 CDD:214999 9/40 (23%)
Cadherin 140..234 CDD:278457 23/110 (21%)
Cadherin_repeat 247..351 CDD:206637 40/108 (37%)
Cadherin 360..462 CDD:278457 26/120 (22%)
Cadherin_repeat 477..573 CDD:206637 30/99 (30%)
E_set <596..669 CDD:298831 25/78 (32%)
Cadherin_C <829..891 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.