DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and DSC1

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_077739.1 Gene:DSC1 / 1823 HGNCID:3035 Length:894 Species:Homo sapiens


Alignment Length:653 Identity:181/653 - (27%)
Similarity:291/653 - (44%) Gaps:103/653 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GVIYVASPLDYET-RPRYELRLEATRNRKNNYTTVVINVRDVNDNPPVFDRQTYRTQITEEDDR- 151
            |.||....|...: |..:.:.|...:.|:.....||::.|: |.:|.  .|.|..|.:.....| 
Human    75 GSIYTTHDLILSSERKSFSIFLSDGQRREQQEIKV
VLSARE-NKSPK--KRHTKDTALKRSKRRW 136

  Fly   152 -NLPKRILQ---------VTATDGDVDRPINIVYFLTGQGIDPDNPANSKFDINRTTGDIFVLKP 206
             .:|..:::         |.....|..:...|.|.::|.|:|.: |.| .|.|.:.|||||..:.
Human   137 APIPASLMENSLGPFPQHVQQIQSDAAQNYTIFYSISGPGVDKE-PFN-LFYIEKDTGDIFCTRS 199

  Fly   207 LDRDQPNGRPQWRFTVFAQDEGGEGLVGYA------------DIQVNLKDINDNAPQFPQGIYFG 259
            :||:        ::..||       |.|||            .:.:.::|.|||||.|...:...
Human   200 IDRE--------KYEQFA-------LYGYATTADGYAPEYPLPLIIKIEDDNDNAPYFEHRVTIF 249

  Fly   260 NVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIEEETGAPIFEIEPETGLIKTAVCCL 324
            .|.||..:|:||..::|.|.|:| ::.:.:|.|.|.:.:.:....   |.|.|:||:|.|....|
Human   250 TVPENCRSGTSVGKVTATDLDEP-DTLHTRLKYKILQQIPDHPKH---FSIHPDTGVITTTTPFL 310

  Fly   325 DRERTPDYSIQVVAMDGG----GLKGTGTASIRVKDLNDMPPQFTKDEWVTEVDETNGTYIPETP 385
            |||:...|.:.:...|.|    ||..|||.:|.::|.||.||.||:..:||||:|..    .:..
Human   311 DREKCDTYQLIMEVRDMGGQPFGLFNTGTITISLEDENDNPPSFTETSYVTEVEENR----IDVE 371

  Fly   386 ILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRNGD---GTGSLKIIQPLDYEDPLQSSGFRFR 447
            ||.:.|||:|..||...|.|.....|.:....:.:.|   ..|.|.:::||:||...|     ..
Human   372 ILRMKVQDQDLPNTPHSKAVYKILQGNENGNFIISTDPNTNEGVLCVVKPLNYEVNRQ-----VI 431

  Fly   448 IQV---NDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDT---KVGTILEQ 506
            :||   |:........|....:..:.|.||:.| :|..|:.   |..|.:.:..   ..|..|..
Human   432 LQVGVINEAQFSKAASSQTPTMCTTTVTVKIID-SDEGPEC---HPPVKVIQSQDGFPAGQELLG 492

  Fly   507 FKATDADQGGHSKVAYKIVRSTNRKRQFAISDR-GAVSIQRPLDRETQ----DRHHIQILAIDDG 566
            :||.|.:......:.|:  :..:....|.|:.. |.:...:.||||::    ::::|.::|:|  
Human   493 YKALDPEISSGEGLRYQ--KLGDEDNWFEINQHTGDLRTLKVLDRESKFVKNNQYNISVVAVD-- 553

  Fly   567 SPARTATATLTVIVKDVNDNAPTFAQDYKPTLPENVSGKKILEVAAKDPDDRLRGNGGPFTFRLD 631
            :..|:.|.||.|.:.|.||:||..  |.:.|:.:|.....:|:..  |||.  ..||.||.|.||
Human   554 AVGRSCTGTLVVHLDDYNDHAPQI--DKEVTICQNNEDFAVLKPV--DPDG--PENGPPFQFFLD 612

  Fly   632 PLASDEIKAGFKVEYDRRGDNENGVAIISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVT 696
            ..||    ..:.:|     :.:...||:...:..|   ...|::||:|||.  ..:..|..|||.
Human   613 NSAS----KNWNIE-----EKDGKTAILRQRQNLD---YNYYSVPIQIKDR--HGLVATHMLTVR 663

  Fly   697 IGD 699
            :.|
Human   664 VCD 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 11/43 (26%)
Cadherin_repeat 140..248 CDD:206637 30/130 (23%)
Cadherin_repeat 256..359 CDD:206637 34/106 (32%)
Cadherin_repeat 379..481 CDD:206637 27/107 (25%)
Cadherin_repeat 489..586 CDD:206637 25/104 (24%)
Cadherin_repeat 594..703 CDD:206637 30/106 (28%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
DSC1NP_077739.1 Cadherin_pro 29..109 CDD:214999 7/33 (21%)
Cadherin 139..233 CDD:278457 25/110 (23%)
Cadherin_repeat 249..350 CDD:206637 35/104 (34%)
Cadherin 359..449 CDD:278457 27/98 (28%)
Cadherin_repeat 485..573 CDD:206637 23/91 (25%)
E_set 596..667 CDD:298831 27/89 (30%)
Cadherin_C <850..888 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9605
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.