DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and Cdh16

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_031689.1 Gene:Cdh16 / 12556 MGIID:106671 Length:830 Species:Mus musculus


Alignment Length:709 Identity:157/709 - (22%)
Similarity:260/709 - (36%) Gaps:186/709 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIFWVLTNSTYLVTKFVRIGIADKNDSPPYFDRFLYETEIDENADLQSTVLTVNAKDHN----ES 66
            :|.|    ...|||    :.:.|:||..|.|.:.:|..::.:........|.:.|.|.:    .:
Mouse   106 RILW----GPQLVT----VHVKDENDQVPQFSQAIYRAQLSQGTRPGVPFLFLEASDGDAPGTAN 162

  Fly    67 TNIRYQITGGN----IGNAFAVQNTTGVIYV----ASPLDYETRPRYELRLEATRNRKNNYTTVV 123
            :::|:.|...:    :.:.|.:....|.:.:    ::.||:.....|:|               :
Mouse   163 SDLRFHILSQSPPQPLPDMFQLDPHLGALALSPSGSTSLDHALEETYQL---------------L 212

  Fly   124 INVRDVNDNPPVFDR-QTYRTQITEED---------DRNL----PKRILQVTATDGDVDRPINIV 174
            :.|:|:.|.|..... .|....|.|..         ..||    |..|.||..:.|||.      
Mouse   213 VQVKDMGDQPSGHQAIATVEISIVENSWAPLEPVHLAENLKVVYPHSIAQVHWSGGDVH------ 271

  Fly   175 YFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADIQ 239
            |.|..|   |..|    ||:: |.|.:.|...|||:   .:.:::..|.||:..||......::|
Mouse   272 YQLESQ---PPGP----FDVD-TEGMLHVTMELDRE---AQAEYQLQVRAQNSHGEDYAEPLELQ 325

  Fly   240 VNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIEEETG 304
            |.:.|.|||||.........|:.|....|:.:..:||.|.|.|. |.|:.::|.:.....||...
Mouse   326 VVVMDENDNAPVCSPHDPTVNIPELSPPGTEIARLSAEDLDAPG-SPNSHIVYQLLSPEPEEGAE 389

  Fly   305 APIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMD----GGGLKGTGTASIRVKDLNDMPPQFT 365
            ...||::|.:|.:......|...::  ..:||:|:|    ..||..|...::.|.|:|:..|:|.
Mouse   390 NKAFELDPTSGSVTLGTAPLHAGQS--ILLQVLAVDLAGSESGLSSTCEVTVMVTDVNNHAPEFI 452

  Fly   366 KDEW--VTEVDETNGTYIPETPILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRNGDGTG--- 425
            ..:.  ||..::..    |...:.|:...|.|....|:..          .|| :..||..|   
Mouse   453 NSQIGPVTLPEDVK----PGALVATLMATDADLEPAFRLM----------DFA-IEEGDPEGIFD 502

  Fly   426 ----------SLKIIQPLDYE--------------DPLQSSGFRFRIQVNDKGDDGPGGSDKYHV 466
                      .|::.:.|.||              :.|...|            .||..:....:
Mouse   503 LSWEPDSDHVQLRLRKNLSYEAAPDHKVVVVVSNIEELVGPG------------PGPAATATVTI 555

  Fly   467 AYSWVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILEQFKATDA-----------DQGGHSKV 520
            ....||..|        |.|:|..|.||...|..|::|...:.:|.           |..|    
Mouse   556 LVERVVAPL--------KLDQESYETSIPVSTPAGSLLLTIQPSDPMSRTLRFSLVNDSEG---- 608

  Fly   521 AYKIVRSTNRKRQFAISDRGAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTV-IVKDVN 584
             :..::..:.:...|.|.:||         :..|.:.:.:.|.|...|..:.:||:.: .:|...
Mouse   609 -WLCIKEVSGEVHTAQSLQGA---------QPGDTYTVLVEAQDTDKPGLSTSATVVIHFLKASP 663

  Fly   585 DNAPTFA-----------QDYKPTLPENVSGKKILEVAAKDPDDRLRGNGGPFTFRLDP 632
            ..|.|.:           |||...    |||      .::|||  |....||::|.|.|
Mouse   664 VPALTLSAGPSRHLCTPRQDYGVV----VSG------VSEDPD--LANRNGPYSFALGP 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637 14/102 (14%)
Cadherin_repeat 140..248 CDD:206637 34/120 (28%)
Cadherin_repeat 256..359 CDD:206637 27/106 (25%)
Cadherin_repeat 379..481 CDD:206637 21/128 (16%)
Cadherin_repeat 489..586 CDD:206637 20/108 (19%)
Cadherin_repeat 594..703 CDD:206637 13/39 (33%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Cdh16NP_031689.1 CA <67..126 CDD:214520 8/27 (30%)
Cadherin_repeat 132..236 CDD:206637 17/118 (14%)
Cadherin_repeat 246..334 CDD:206637 31/104 (30%)
Cadherin_repeat 344..447 CDD:206637 28/105 (27%)
Cadherin_repeat 459..560 CDD:206637 20/127 (16%)
Cadherin_repeat 570..657 CDD:206637 19/100 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.