DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and LOC103909937

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001315629.1 Gene:LOC103909937 / 103909937 -ID:- Length:935 Species:Danio rerio


Alignment Length:675 Identity:182/675 - (26%)
Similarity:296/675 - (43%) Gaps:117/675 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 DVDRPINIVYFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQ---WRFTVFAQDE 227
            |:...:|.:.|...: ||.:.......|||..||::.|.:.:||::..|...   .:|....:|.
Zfish    38 DLGLDVNRLSFRKAR-IDTEGNRKRYCDINLNTGELTVAERIDREEICGDRASCVLKFEFMLEDP 101

  Fly   228 GGEGLVGYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIY 292
                 :....:.:.::|||||:|.|.:.:....:||:...|:.....:|.|.|   ...||...|
Zfish   102 -----LELHRVSLQIQDINDNSPVFSKDLITFEITESTFRGTRYRLNAAHDAD---IGQNAVQRY 158

  Fly   293 SIEKN------VIEEETGAPIFE--IEPETGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGT 349
            |::||      :..:..|....|  :|.|          ||||:..:.::.:.|:|||....:||
Zfish   159 SLQKNDNFQLAINSDVHGEKNLELLLEKE----------LDREQQKEVTLILTAVDGGTPPRSGT 213

  Fly   350 ASIRVK--DLNDMPPQFTKDEWVTEVDETNGTYIPETPILTVTVQDEDE--TNTFQYKVVPNSGF 410
            .:|.|.  |.||..|.|::..:...:.|.:..   :|.::||:..|.||  .....|:....|..
Zfish   214 VAIHVTVLDANDNAPVFSQAVYKVSLPENSPV---DTVVVTVSATDADEGQNGEVMYEFSRISDK 275

  Fly   411 GADKFAMVRNGDGTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAY-SWVVVK 474
            ....|::.:|   ||.::|...||:||   .:.:..|::          |.|.:.::. :.||:.
Zfish   276 AKKLFSLDKN---TGDIRIAGALDFED---EAVYELRVE----------GKDVFGLSSDAKVVIN 324

  Fly   475 LRDINDNVP----KFDREHIEVSIYEDTKVGTILEQFKATDADQGG------HSKVAYKIVRSTN 529
            |.|:|||.|    |..|..:..|....|:||.|..|.:  |::..|      ...|.:|:|.|. 
Zfish   325 LSDVNDNAPEIRLKSLRSPVPESALPGTEVGIINVQDR--DSENNGQVRCSIQQNVPFKLVPSI- 386

  Fly   530 RKRQFAISDRGAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTF-AQD 593
             |..:::...|      .||||....::|.|:|.|:|||..::|..:.:.|.|||||.|.| .|:
Zfish   387 -KNYYSLVTTG------ELDRELLSEYNITIIATDEGSPPLSSTKNIHLTVADVNDNPPVFQQQN 444

  Fly   594 YKPTLPE-NVSGKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVA 657
            |:..:.| |.:|..|..|:|.|||.|..|     |.....|:||...|.........||    ..
Zfish   445 YRAHVQENNKAGSSICSVSATDPDWRQNG-----TVVYSLLSSDVSGAPVSSFLSINGD----TG 500

  Fly   658 IISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTIGDVNDNKMQPGSKSVLVYNYQGQSQ 722
            :|.::|.||.|..||:.:.:..:|||:|.::...|::|.|.|.|||     |..:|..:.:|.|.
Zfish   501 VIHAVRSFDYEQMKSFKVLVLARDNGSPPLSCNVTVSVFISDENDN-----SPQILYPSPEGNSF 560

  Fly   723 DTP-----------IGRVYVNDPDDWDVPDKKYYWEVQEHQRFKLDTDTGILTMRAGTRRGRYQL 776
            .|.           :.:|...|.|........|:        ....||.|:.|:  |...|..:.
Zfish   561 MTEMVPKAAQARSLVSKVIAVDTDSGQNAWLSYH--------IIKATDPGLFTI--GVHSGEIRT 615

  Fly   777 RFKVYDREHGQED-IPANLSVTVRD 800
            :     |:..:.| :..||.|:|||
Zfish   616 Q-----RDISESDSMKQNLIVSVRD 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 19/84 (23%)
Cadherin_repeat 256..359 CDD:206637 29/112 (26%)
Cadherin_repeat 379..481 CDD:206637 25/104 (24%)
Cadherin_repeat 489..586 CDD:206637 30/102 (29%)
Cadherin_repeat 594..703 CDD:206637 35/109 (32%)
Cadherin_repeat 724..801 CDD:206637 19/89 (21%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
LOC103909937NP_001315629.1 Cadherin_2 18..100 CDD:285466 15/62 (24%)
Cadherin_repeat 126..226 CDD:206637 30/112 (27%)
Cadherin_repeat 234..331 CDD:206637 26/115 (23%)
Cadherin_repeat 344..436 CDD:206637 30/101 (30%)
Cadherin_repeat 445..546 CDD:206637 35/109 (32%)
Cadherin_repeat 565..653 CDD:206637 18/86 (21%)
Cadherin_C_2 673..757 CDD:293101
Cadherin_tail 793..921 CDD:292596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.