DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and CDH18

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001278885.1 Gene:CDH18 / 1016 HGNCID:1757 Length:790 Species:Homo sapiens


Alignment Length:573 Identity:171/573 - (29%)
Similarity:266/573 - (46%) Gaps:108/573 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 DGDVDRPINIVYFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQ--- 225
            ||.|.      |.|||:|      |.:.|.|:.|||||...|.|||:|     :..:.:.||   
Human    85 DGSVK------YILTGEG------AGTIFIIDDTTGDIHSTKSLDREQ-----KTHYVLHAQAID 132

  Fly   226 DEGGEGLVGYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKL 290
            ....:.|...::..:.::|||||||:|..|.|...|.|....|:||:.::|.|.|||....:|::
Human   133 RRTNKPLEPESEFIIKVQDINDNAP
KFTDGPYIVTVPEMSDMGTSVLQVTATDADDPTYGNSARV 197

  Fly   291 IYSIEKNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMD----GGGLKGTGTAS 351
            :|||.:       |.|.|.::|:||:|:||:..:|||....||:.:.|.|    .|||.|:.|.:
Human   198 VYSILQ-------GQPYFSVDPKTGVIRTALHNMDREAREHYSVVIQAKDMAGQVGGLSGSTTVN 255

  Fly   352 IRVKDLNDMPPQFTKDEWVTEVDETNGTYIPE-----TPILTVTVQDEDETNTFQYKVVPNSGFG 411
            |.:.|:||.||:|.:..:        ..|:||     :.:..:...|.|            :|..
Human   256 ITLTDVNDN
PPRFPQKHY--------QLYVPESAQVGSAVGKIKANDAD------------TGSN 300

  Fly   412 ADKFAMVRNGDGTG---------------SLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGS 461
            ||....:.||||.|               |||  :||:||   :...:...|:         |.:
Human   301 ADMTYSIINGDGMGIFSISTDKETREGILSLK--KPLNYE---KKKSYTLNIE---------GAN 351

  Fly   462 DKYHVAYS---------WVVVKLRDINDNVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGH 517
            ......:|         .:.:.:.|: |..|.|......:.:||:.|:||::....|.|.| ..:
Human   352 THLDFRFSHLGPFKDATMLKIIVGDV-DE
PPLFSMPSYLMEVYENAKIGTVVGTVLAQDPD-STN 414

  Fly   518 SKVAYKIVRSTNRKRQFAI-SDRGAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVK 581
            |.|.|.|..:....|.|.| ::.|.:...:.||||....::|.:.|.:..:|...:..|:.:.|.
Human   415 SLVRYFINYNVEDDRFFNIDANTGTIRTTKVLDREETPWYNITVTASEIDNPDLLSHVTVGIRVL 479

  Fly   582 DVNDNAPTFAQDYKPTLPENVS-GKKILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVE 645
            |||||.|..|::|...:.||.. |:.|..::|.|.||  ..||..|.|.||...  .:...|.::
Human   480 DVNDN
PPELAREYDIIVCENSKPGQVIHTISATDKDD--FANGPRFNFFLDERL--PVNPNFTLK 540

  Fly   646 YDRRGDNE-NGVAIISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTSTLTVTI 697
                 ||| |..:|::..|.|.|..|..|.:||.|.|.|.|:::.:||||:.:
Human   541 -----DNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSSSTLTIRV 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 27/86 (31%)
Cadherin_repeat 256..359 CDD:206637 38/106 (36%)
Cadherin_repeat 379..481 CDD:206637 24/130 (18%)
Cadherin_repeat 489..586 CDD:206637 28/97 (29%)
Cadherin_repeat 594..703 CDD:206637 36/106 (34%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
CDH18NP_001278885.1 CA 79..157 CDD:214520 29/88 (33%)
Cadherin_repeat 163..264 CDD:206637 39/107 (36%)
Cadherin_repeat 272..379 CDD:206637 24/141 (17%)
Cadherin_repeat 387..484 CDD:206637 28/97 (29%)
Cadherin_repeat 491..589 CDD:206637 36/107 (34%)
Cadherin_C 637..783 CDD:307269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.