DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and CDH15

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_004924.1 Gene:CDH15 / 1013 HGNCID:1754 Length:814 Species:Homo sapiens


Alignment Length:633 Identity:171/633 - (27%)
Similarity:272/633 - (42%) Gaps:138/633 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PPVFDRQTYRTQITEEDDRNLPKRILQVTATDGDVDRPINIVYFLTGQGIDPDNPANSKFDINRT 197
            ||:         ...|:.:.||..::|:.:   |..:..:::|.:.|.|:|.:  ....|.|::.
Human    50 PPI---------SVSENHKRLPYPLVQIKS---DKQQLGSVIYSIQGPGVDEE--PRGVFSIDKF 100

  Fly   198 TGDIFVLKPLDRDQPNGRPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQFPQGIYFGNVT 262
            ||.:|:...|||::.:   ::|...||.|.||..|....|:::.:.|.|||.|.|.|..:.|.|.
Human   101 TGKVFLNAMLDREKTD---RFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVL 162

  Fly   263 ENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKNVIEEETGAP-IFEIEPETGLIKTAVCCLDR 326
            |....|:.|....|.|.||| |:.||.|.:||      .:.|:| :|.|:..||.|:|....|||
Human   163 EGAVPGTYVTRAEATDADDP-ETDNAALRFSI------LQQGSPELFSIDELTGEIRTVQVGLDR 220

  Fly   327 ERTPDY--SIQVVAMDGGGLKGTGTASIRVKDLNDMPPQFTKDEW-------VTEVD----ETNG 378
            |....|  ::||..|.|.||..|.:|.|.:.|:||..|:||:||:       |:.||    |...
Human   221 EVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVED 285

  Fly   379 TYIPETP--ILTVTVQDEDETNTFQYKVVPNSGFGADKFAMVRNGDGTGSLKIIQPLDYED---- 437
            ..:|.:|  :...|:.:.|....|..:..|.:              ..|.|.|::.||||.    
Human   286 RDLPGSPNWVARFTILEGDPDGQFTIRTDPKT--------------NEGVLSIVKALDYESCEHY 336

  Fly   438 ----------PLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEV 492
                      |||::..|     .::|.             :.|.|.::|.|: .|.|....:..
Human   337 ELKVSVQNEAPLQAAALR-----AERGQ-------------AKVRVHVQDTNE-PPVFQENPLRT 382

  Fly   493 SIYEDTKVGTILEQFKATDADQGGHSKVAY----------KIVRSTNRKRQFAISDRGAVSIQRP 547
            |:.|....||::..|.|.|.|.....:::|          ::..:|.|     |..:..:|...|
Human   383 SLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGR-----IQTQHVLSPASP 442

  Fly   548 LDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDYKPTLP-----ENVSGKKI 607
            ..:  ...:...:||.||.|..||||.||::.:.:|||:||..|    |..|     |...|..:
Human   443 FLK--GGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHAPVLA----PPPPGSLCSEPHQGPGL 501

  Fly   608 LEVAAKDPDDRLRGNGGPFTFRLDP----LASDEIKAGFKVEYDRRGDNENGVAIISSLRPFDRE 668
            | :.|.|.|  |..:|.||.|:|.|    |..:...:...|.:.|             |||..:.
Human   502 L-LGATDED--LPPHGAPFHFQLSPRLPELGRNWSLSQVNVSHAR-------------LRPRHQV 550

  Fly   669 AQKSYAIPIEIKDNGAPAMTGTSTLTVTI---GDVNDNKMQPGSKSVL 713
            .:..:.:.:.::|:|.|.......|.||:   |  .|....||:.::|
Human   551 PEGLHRLSLLLRDSGQPPQQREQPLNVTVCRCG--KDGVCLPGAAALL 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 27/107 (25%)
Cadherin_repeat 256..359 CDD:206637 39/105 (37%)
Cadherin_repeat 379..481 CDD:206637 22/117 (19%)
Cadherin_repeat 489..586 CDD:206637 27/106 (25%)
Cadherin_repeat 594..703 CDD:206637 28/120 (23%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
CDH15NP_004924.1 Cadherin_repeat 52..148 CDD:206637 27/112 (24%)
Cadherin_repeat 157..256 CDD:206637 40/105 (38%)
Cadherin_repeat 271..371 CDD:206637 25/131 (19%)
Cadherin_repeat 379..479 CDD:206637 27/106 (25%)
E_set 487..580 CDD:298831 26/108 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 636..663
Cadherin_C 640..781 CDD:279398
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.