DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and CDH12

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001304156.1 Gene:CDH12 / 1010 HGNCID:1751 Length:794 Species:Homo sapiens


Alignment Length:551 Identity:170/551 - (30%)
Similarity:276/551 - (50%) Gaps:61/551 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 DVDRPINIV-YFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQD-EG 228
            |:|:....| |.|:|.|      |.:.|.|:.|||||..::.|||::   :|.:.....|.| |.
Human    81 DLDKGEGTVKYTLSGDG------AGTVFTIDETTGDIHAIRSLDREE---KPFYTLRAQAVDIET 136

  Fly   229 GEGLVGYADIQVNLKDINDNAPQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYS 293
            .:.|...::..:.::|||||.|:|..|.|...|.|....|:.|:.:.|.|.|||....:|:::||
Human   137 RKPLEPESEFIIKVQDINDNEP
KFLDGPYVATVPEMSPVGAYVLQVKATDADDPTYGNSARVVYS 201

  Fly   294 IEKNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMDG----GGLKGTGTASIRV 354
            |.:       |.|.|.|:|:||:|:||:..:|||....|.:.:.|.|.    |||.||...:|.:
Human   202 ILQ-------GQPYFSIDPKTGVIRTALPNMDREVKEQYQVLIQAKDMGGQLGGLAGTTIVNITL 259

  Fly   355 KDLNDMPPQFTKDEWVTEVDETN--GTYIPETPILTVTVQDED--ETNTFQYKVVPNSGFGADKF 415
            .|:||.||:|.|..:..:|.|::  |:.|..     :...|.|  :....:|.:||  |.|.:.|
Human   260 TDVNDN
PPRFPKSIFHLKVPESSPIGSAIGR-----IRAVDPDFGQNAEIEYNIVP--GDGGNLF 317

  Fly   416 AMVRNGD-GTGSLKIIQPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVA-----YSWVVVK 474
            .:|.:.| ..|.:|:.:|||:|   ....:.|:::.::...|     .::|.|     .:.|.:.
Human   318 DIVTDEDTQEGVIKLKKPLDFE---TKKAYTFKVEASNLHLD-----HRFHSAGPFKDTATVKIS 374

  Fly   475 LRDINDNVPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAI-SD 538
            :.|: |..|.|.:....:.:||||.||||:....|.|.|.|. |.|.|.|...::....|.| .:
Human   375 VLDV-DE
PPVFSKPLYTMEVYEDTPVGTIIGAVTAQDLDVGS-SAVRYFIDWKSDGDSYFTIDGN 437

  Fly   539 RGAVSIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDNAPTFAQDYKPTLPENVS 603
            .|.::....||||:..:::..|:|....:|..|:...:.:.|.|||:..|..:..|:..:.||..
Human   438 EGTIATNELLDRESTAQYNFSIIASKVSNPLLTSKVNILINVLDVNE
FPPEISVPYETAVCENAK 502

  Fly   604 GKKILE-VAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIISSLR-PFD 666
            ..:|:: |:|.|.|  |...|..|:|||.|.|:  ||..|.|.     |..|..|.|.:.| .:.
Human   503 PGQIIQIVSAADRD--LSPAGQQFSFRLSPEAA--IKPNFTVR-----DFRNNTAGIETRRNGYS 558

  Fly   667 REAQKSYAIPIEIKDNGAPAMTGTSTLTVTI 697
            |..|:.|.:|:.|:|:..|..:.|:|:|:.:
Human   559 RRQQELYFLPVVIEDSSYPVQSSTNTMTIRV 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 26/83 (31%)
Cadherin_repeat 256..359 CDD:206637 37/106 (35%)
Cadherin_repeat 379..481 CDD:206637 23/109 (21%)
Cadherin_repeat 489..586 CDD:206637 31/97 (32%)
Cadherin_repeat 594..703 CDD:206637 35/106 (33%)
Cadherin_repeat 724..801 CDD:206637
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
CDH12NP_001304156.1 CA 80..158 CDD:214520 28/85 (33%)
Cadherin_repeat 164..265 CDD:206637 38/107 (36%)
Cadherin_repeat 273..380 CDD:206637 26/122 (21%)
Cadherin_repeat 389..484 CDD:206637 30/95 (32%)
Cadherin_repeat 492..590 CDD:206637 35/107 (33%)
Cadherin_C 638..785 CDD:307269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.