DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN2 and pcdh1g33

DIOPT Version :9

Sequence 1:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster
Sequence 2:NP_001103206.2 Gene:pcdh1g33 / 100003438 ZFINID:ZDB-GENE-071004-76 Length:970 Species:Danio rerio


Alignment Length:704 Identity:181/704 - (25%)
Similarity:295/704 - (41%) Gaps:104/704 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 FDINRTTGDIFVLKPLDRDQ---PNGRPQWRFTVFAQDEGGEGLVGYADIQVNLKDINDNAPQFP 253
            |.:|...|::.|.:.:||::   .:.|......|..:|.     :.:..:.|:::|||||:|.|.
Zfish    75 FSVNLRNGELLVNELIDREKLCGQSARCVLPLQVIIEDP-----LQFYRVDVDIQDINDNSPSFL 134

  Fly   254 QGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLIYSIEKN------VIEEETGAPIFEIEP 312
            ....|.:|:|....|:......|.|.|   ..:|:...|::.||      |..::.|..:    |
Zfish   135 SDTKFIDVSETTLTGARFRLEPAQDAD---VGSNSLRTYALNKNDYFILQVKNDKDGTKV----P 192

  Fly   313 ETGLIKTAVCCLDRERTPDYSIQVVAMDGGGLKGTGTA--SIRVKDLNDMPPQFTKDEWVTEVDE 375
            |..|.|    .||||:.....:.::.:|||....:||.  ::||.|:||..|.|.:|.:..:|.|
Zfish   193 EIVLQK----ALDREKQSIEHLILMGIDGGDPASSGTTQITVRVLDVNDNAPVFEQDLYEIKVME 253

  Fly   376 TNGTYIPETPILTVTVQDEDE--TNTFQYKVVPNSGFGADKFAMVRN----GDGTGSLKIIQPLD 434
            ...   |.|.|..|...|.|:  .:..:|.:      |:|....::|    ...||.|||.:.||
Zfish   254 NAA---PGTIIQIVKAIDLDDGLNSEIEYSL------GSDTPETLKNLFSINSNTGELKISKSLD 309

  Fly   435 YEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLRDINDNVPKFDREHIEVSIYEDTK 499
            ||   .|:.::..|:..|||  ||     ....:..|.|.:.|:|||.|:.........:.||..
Zfish   310 YE---MSTTYKIDIRARDKG--GP-----VMEGHCRVQVNVLDVNDNAPEIIITSSPKPVREDAP 364

  Fly   500 VGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRGAVSIQRPLDRETQDRHHIQILAID 564
            .||::......|.|.|.:..|...|:..|..|.:...::..|:.....||||...::.|::.|.|
Zfish   365 AGTMVALINVKDLDSGINGNVTLLILSDTPFKLKPTFANHYALVTDSKLDREKFPKYDIELKASD 429

  Fly   565 DGSPARTATATLTVIVKDVNDNAPTFAQD-YKPTLPEN-VSGKKILEVAAKDPDDRLRGNGGPFT 627
            .|||...::..:||.:.|||||.|.|::. |...:.|| ..|..:..|.|.|.|   .|......
Zfish   430 SGSPPLVSSKLITVNILDVNDNPPVFSERVYSVYIKENSAPGSILASVTASDLD---TGENAKIV 491

  Fly   628 FRLDPLASDEIKAGFKVEYDRRGDNENGVAIISSLRPFDREAQKSYAIPIEIKDNGAPAMTGTST 692
            :.:....:.::.....|..:.    |||  .|.|:..||.|..|.:.:.:..||.|:.:::..:|
Zfish   492 YSVIDTNTRDVPVSSYVYINA----ENG--SIFSMHSFDYEKIKVFHVIVLAKDQGSQSLSSNAT 550

  Fly   693 LTVTIGDVNDNK---MQPGSKSVLVYNYQGQSQDTPIG----RVYVNDPDD----WDVPDKKYY- 745
            :.|.|.|.|||.   :.|.:....|.| |...:....|    :|...|.|.    |     .:| 
Zfish   551 VHVFILDQNDNAPAVIYPSTSMGSVSN-QRMPRSAKAGHLVTKVTAVDADSGHNAW-----LFYR 609

  Fly   746 -WEVQEHQRFKLDTDTG-ILTMRAGTRRGRYQLRFKVYDREHGQEDIPA-NLSVTVRDITAEAVQ 807
             .|..:...|.::..|| :.|.||.:.......|..:..:::|:   |. :.:|||..:..|.|.
Zfish   610 LAEATDASLFSVNLHTGEVRTKRAVSEHDDSSQRLVIEIKDNGE---PVQSTTVTVDILIEEGVY 671

  Fly   808 QAGSMRLSHITDEDFVRTWNPVKNQVEPSKLERFRNKLAELLYTDRDNVDVFSV 861
            :.       |::.:...|.|..|..          .|:...|......|.|.||
Zfish   672 EP-------ISEYNMKTTENNNKKS----------GKITLYLIISLGTVSVLSV 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 13/58 (22%)
Cadherin_repeat 256..359 CDD:206637 29/110 (26%)
Cadherin_repeat 379..481 CDD:206637 30/107 (28%)
Cadherin_repeat 489..586 CDD:206637 27/96 (28%)
Cadherin_repeat 594..703 CDD:206637 27/109 (25%)
Cadherin_repeat 724..801 CDD:206637 19/88 (22%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
pcdh1g33NP_001103206.2 Cadherin_2 30..112 CDD:311943 8/36 (22%)
Cadherin_repeat 142..238 CDD:206637 29/106 (27%)
Cadherin_repeat 247..346 CDD:206637 32/117 (27%)
Cadherin_repeat 359..451 CDD:206637 27/91 (30%)
Cadherin_repeat 459..561 CDD:206637 27/110 (25%)
Cadherin_repeat 581..667 CDD:206637 19/93 (20%)
Cadherin_C_2 692..>720 CDD:318652 5/17 (29%)
Cadherin_tail 819..956 CDD:318236
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.