DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and PCDHB14

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:NP_061757.1 Gene:PCDHB14 / 56122 HGNCID:8685 Length:798 Species:Homo sapiens


Alignment Length:713 Identity:185/713 - (25%)
Similarity:306/713 - (42%) Gaps:123/713 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   640 LSIVGGKRA---PQFYMPSYEAEIPE---NQKKD-----SDIISIKAKSFADREIRYTLKAQGQG 693
            |.::|..||   ...|..:.|.||..   |..:|     .::.|.:|:..:|...:|        
Human    18 LVLLGLSRAGTESAHYSVAEETEIGSFVANLARDLGLGVEELSSREARVVSDDNKKY-------- 74

  Fly   694 AGTFNIGPTSGIVKLAKELDFEDL---RQPHVYSLIVTATEDSGGFSTSVDLTIRVTDVNDNAPK 755
               .::...:|.:.|.::||.::|   .:|.|....|........|.    ..:.|.|:||::|.
Human    75 ---LHLDLLTGNLLLNEKLDRDELCGSTEPCVLHFQVVLENPLQFFR----FELCVKDINDHSPT 132

  Fly   756 FELPDYQAHNVDEDIPLGTSILRVKAMDSDSGSNAEIEYLVS-DDHFAV---DSNG-----IIVN 811
            | |.......:.|...:|.:.|...|.|.|.|||:...|.:| :.||.:   ||:.     .:|.
Human   133 F-LDKEILIKISEGTTVGATFLMESAQDLDVGSNSLQNYTISPNSHFYIKIPDSSDRKIYPELVL 196

  Fly   812 NKQLDADNNNAYYEFIVTAKDKGEPPKSGVATVRVYTKNKNDEEPKFSQQVYTPNVDENAGPNTL 876
            ::.||.: ..|.....:||.|.|.|||||...|.:...:.||..|:|.|.:|...|.|:....:.
Human   197 DRALDYE-QEAELRLTLTAVDGGSPPKSGTTLVLIKVLDINDNAPEFPQSLYEVQVPEDRPLGSW 260

  Fly   877 VTTVVASDKDGDN---VRFGFVGGGTSSGQ-FVIEDITGVIRLHNKAISLDKD---KYELNVTAM 934
            :.|:.|.|.|..|   :.:.|........: |.|..|:|.:.|.:   .||.:   .|.:|:.|.
Human   261 IATISAKDLDAGNYGKISYTFFHASEDIRKTFEINPISGEVNLRS---PLDFEVIQSYTINIQAT 322

  Fly   935 DDGSCCVNGDQTIHTSTAVVVVFITDVNDNKPVFKDCSTYYPKVEEGAPNGSPVIKVVAT--DED 997
            |.|.  ::|..|:       :|.:.|:|||.|.. ..|:...::.|   |.|..:..:.:  |:|
Human   323 DGGG--LSGKCTL-------LVKVMDINDNPPEV-TISSITKRIPE---NASETLVALFSILDQD 374

  Fly   998 KGVNGQVKYSIVQ------QPNQKGTKFTVDEETGEVSTNKVFDREGDDGKFVSVTVKATDQGDP 1056
            .|.||::..||..      :|..|.. ||:..|       |..|||......:::||  ||.|.|
Human   375 SGDNGRMICSIQDNLPFFLKPTFKNF-FTLVSE-------KALDRESQAEYNITITV--TDLGTP 429

  Fly  1057 SLEGVCSFTVEITDVNDNPPLFDRQKYVENVKQDASIGTNILRVSASDEDADNNGAIVYSLTAPF 1121
            .|:...:.||.::|||||.|.|.:..|...|:::.|...:|..|||:|.|:..|..:.|||   .
Human   430 RLKTEYNITVLLSDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVNYSL---L 491

  Fly  1122 NPND-----LEYFEIQAESGWIVLKKPLDGCYPR-DRYRLRVSASDKGTPASAADVDVELDVVDR 1180
            .|.|     .....|.|::|.:...:.||  |.. ..:..||.|:|:|:||.:::..|.:.|:|.
Human   492 PPQDRHLPLASLVSINADNGHLFALRSLD--YEALQEFEFRVGATDRGSPALSSEALVRVLVLDA 554

  Fly  1181 NNKPPIWDKSIYGPIH---------IRENVTVGTVVTSVKASSGIEG-NPTVFYRLMPGSTAQTN 1235
            |:..|.    :..|:.         :......|.:||.|.|..|..| |..:.|:|:..:     
Human   555 NDNSPF----VLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKAT----- 610

  Fly  1236 KFHTFYLQQRPDNGDTWA---DIKVNHPLDYESIKEYNLTIRVENNGAQQLASEATVYIMLED 1295
                     .|.....||   :::....|......::.|.:.|::||....::.||::::|.|
Human   611 ---------EPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVLLVD 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637 21/107 (20%)
Cadherin_repeat 765..853 CDD:206637 29/96 (30%)
Cadherin_repeat 862..964 CDD:206637 26/108 (24%)
Cadherin_repeat 973..1074 CDD:206637 31/108 (29%)
Cadherin_repeat 1083..1166 CDD:206637 26/88 (30%)
Cadherin_repeat <1219..1298 CDD:206637 15/80 (19%)
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637
Cadherin_repeat 1638..1741 CDD:206637
Cadherin_repeat 1762..1861 CDD:206637
Cadherin_repeat 1871..1966 CDD:206637
Cadherin_repeat 1974..2083 CDD:206637
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
PCDHB14NP_061757.1 Cadherin_2 32..112 CDD:285466 18/90 (20%)
Cadherin_repeat 140..238 CDD:206637 30/98 (31%)
Cadherin_repeat 247..343 CDD:206637 26/107 (24%)
Cadherin_repeat 355..447 CDD:206637 31/104 (30%)
Cadherin_repeat 455..557 CDD:206637 32/106 (30%)
Cadherin_repeat 576..664 CDD:206637 21/101 (21%)
Cadherin_C_2 685..768 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.