DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and egfl6

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:XP_017213153.1 Gene:egfl6 / 436730 ZFINID:ZDB-GENE-040718-157 Length:539 Species:Danio rerio


Alignment Length:363 Identity:67/363 - (18%)
Similarity:99/363 - (27%) Gaps:188/363 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly  2580 GLSRNSVAGCPQTEEVCAQTETTARC---WEHGNCVGSLSEARCHCRPGWTGPACN-------IP 2634
            |..:|:...|            .|:|   .:||.|||   ..:|.|.||:||..|:       :.
Zfish    49 GWKKNTKGQC------------EAQCDLGCKHGECVG---PNKCKCFPGYTGKTCSQDLNECGLK 98

  Fly  2635 TIPTTFKAQ----SYVKYALSFEPDRFSTQVQLRFRTREEYGELFRVSDQHNREYGILEIKDGH- 2694
            ..|...:..    ||:.|.|:                                  |.:.:.||. 
Zfish    99 PRPCEHRCMNTFGSYMCYCLN----------------------------------GYMLMPDGSC 129

  Fly  2695 --------LHFRYNLNSLRTEEKDLWLNAIVVNDGQWHVVKVNRYGSAATLELDGGEGRRYNETF 2751
                    .|.:|....:::|     :..:..:.|               |:| |.:|       
Zfish   130 ANSRTCSLAHCQYGCEEVQSE-----VRCLCPSPG---------------LQL-GSDG------- 166

  Fly  2752 EFVGHQWLLVDKQEGVYAGGKAEYTGVRTFEVYADYQKSCLD-DIRLEGKHLPLPPAMNGTQWGQ 2815
                                                 |:|.| |....||:              
Zfish   167 -------------------------------------KTCEDIDECATGKN-------------- 180

  Fly  2816 ATMARNLEKGCPSNKPCSNVICPDPFECVDLWNVYECTCGEGRIMSPDSK------GCMDRNECL 2874
                     .||.|:.|:|.           :..|.|.|..|.    |.|      .|:|.|||.
Zfish   181 ---------QCPFNRQCTNT-----------FGSYYCKCQPGY----DLKYINGKYDCVDVNECT 221

  Fly  2875 D--MPCMNGATCINLEPRLRYRCICPDGFWGE--NCEL 2908
            .  ..|.:.|.|||...  .|:|.|..||.|.  :|.:
Zfish   222 SNTHKCSHHAECINTLG--SYKCKCKQGFRGSGFDCSV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637
Cadherin_repeat 1638..1741 CDD:206637
Cadherin_repeat 1762..1861 CDD:206637
Cadherin_repeat 1871..1966 CDD:206637
Cadherin_repeat 1974..2083 CDD:206637
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248 12/28 (43%)
Laminin_G_2 2665..2800 CDD:280389 15/144 (10%)
EGF_CA 2869..2907 CDD:238011 15/41 (37%)
Cadherin_C 2952..3088 CDD:279398
egfl6XP_017213153.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.