DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and MFGE8

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:NP_005919.2 Gene:MFGE8 / 4240 HGNCID:7036 Length:387 Species:Homo sapiens


Alignment Length:298 Identity:61/298 - (20%)
Similarity:109/298 - (36%) Gaps:83/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  2314 PLPYMVNANKTALVGVRVDTIADCTCGARNFTKPESCRTTPCHNGGRCVDTR-------FGPH-C 2370
            |.|.::.|...||:           |........:.|...||||||.|.:..       |..: |
Human     2 PRPRLLAALCGALL-----------CAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTC 55

  Fly  2371 SCPVGYTGPRCQQTTRSFRGNGWAWYPPLEMCDESHLSLEFITRKPDGLIIYNGPIVPPERDETL 2435
            :|..||.|..|:                              |:..:.|.:.||.|...:...:.
Human    56 TCLKGYAGNHCE------------------------------TKCVEPLGLENGNIANSQIAASS 90

  Fly  2436 ISDFIALELERGYPRLLIDFGSGTLELRVKTKKTLDDGEWHRIDL---FWDTESIRMVV------ 2491
            :. ...|.|:...|.|.....:|.  :...|..:.||..|.:::|   .|.|..:....      
Human    91 VR-VTFLGLQHWVPELARLNRAGM--VNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASH 152

  Fly  2492 DFCKSAEIAEMEDGTPPEFD---DMSCQARGQIPPFNE---YLNV-NAPLQVGGLYREQFDQSLY 2549
            ::.|:.::|...:|  .|||   |::.:.:..:..:|:   ::|: ..|::.      |:.: ||
Human   153 EYLKAFKVAYSLNG--HEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEA------QYVR-LY 208

  Fly  2550 FWHYMPTAKGFDGCIRNLVHNSKLYDLAHP-GLSRNSV 2586
                 ||:......:|..:...:|...|:| ||..||:
Human   209 -----PTSCHTACTLRFELLGCELNGCANPLGLKNNSI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637
Cadherin_repeat 1638..1741 CDD:206637
Cadherin_repeat 1762..1861 CDD:206637
Cadherin_repeat 1871..1966 CDD:206637
Cadherin_repeat 1974..2083 CDD:206637
EGF 2350..2380 CDD:278437 14/37 (38%)
LamG 2385..2570 CDD:238058 33/200 (17%)
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
MFGE8NP_005919.2 EGF_CA 28..67 CDD:238011 13/38 (34%)
Cell attachment site 46..48 0/1 (0%)
FA58C 72..224 CDD:238014 32/168 (19%)
FA58C 232..386 CDD:238014 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.