Sequence 1: | NP_001027277.1 | Gene: | CadN / 35070 | FlyBaseID: | FBgn0015609 | Length: | 3101 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_989110.1 | Gene: | naa20 / 394715 | XenbaseID: | XB-GENE-969863 | Length: | 178 | Species: | Xenopus tropicalis |
Alignment Length: | 198 | Identity: | 41/198 - (20%) |
---|---|---|---|
Similarity: | 63/198 - (31%) | Gaps: | 70/198 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 2840 PFECVDL--------------------------WNVY----ECTCGE--GRIMSPDSKGCMDRNE 2872
Fly 2873 CLDMPCMNG-ATCINLEPRLRYRCICPDGFWGENCELVQEGQTLKLSMGALAAILVCLLIILILV 2936
Fly 2937 LVFVVYNRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQ---------IPIGGPM 2992
Fly 2993 PPE 2995 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E33208_3CNY1 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
2 | 1.860 |