DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and Cdh18

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:NP_001101126.2 Gene:Cdh18 / 310174 RGDID:1305430 Length:790 Species:Rattus norvegicus


Alignment Length:590 Identity:179/590 - (30%)
Similarity:283/590 - (47%) Gaps:109/590 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1521 PTYRTQITEEDDRNLPKRVLQVTATDGDKDRPQNIVYFLTGQGIDPDNPANSKFDINRTTGEIFV 1585
            |.|..::....|:.           ||      ::.|.|||:|      |.:.|.|:.|||:|..
  Rat    71 PQYVGKLHSNSDKG-----------DG------SVKYILTGEG------AGTIFIIDDTTGDIHS 112

  Fly  1586 LKPLDRDQPNGRPQWRFTVFAQ---DEGGEGLVGYADVQVNLKDINDNAPIFPQGVYFGNVTENG 1647
            .|.|||:|     :..:.:.||   ....:.|...::..:.::|||||||.|..|.|...|.|..
  Rat   113 TKSLDREQ-----KTHYVLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMS 172

  Fly  1648 TAGMVVMTMTAVDYDDPNEGSNARLVYSIEKNVIEEETGSPIFEIEPDTGVIKTAVCCLDRERTP 1712
            ..|..|:.:||.|.|||..|::||:||||.:       |.|.|.::|.||||:||:..:|||...
  Rat   173 DMGTSVLQVTATDADDPTYGNSARVVYSILQ-------GQPYFSVDPKTGVIRTALHNMDREARE 230

  Fly  1713 DYSIQVVAMD----GGGLKGTGTASIRVKDINDMPPQFTKDEWFTEVDETD--GTALPEMPILTV 1771
            .||:.:.|.|    .|||.|:.|.:|.:.|:||.||:|.:..:...|.|:.  |:|:.:     :
  Rat   231 HYSVVIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGK-----I 290

  Fly  1772 TVHDEDETNKFQYKVIDNSGYGADKFTMVRNNDG-------------TGSLKIVQPLDYEDQ--- 1820
            ..:|.|            :|..||....:.|.||             .|.|.:.:||:||.:   
  Rat   291 KANDAD------------TGSNADMTYSITNGDGIGVFSISTDKDTREGILSLKKPLNYEKKKSY 343

  Fly  1821 -LQSNG------FRFRIQVNDKGEDNDNDKYHVAYSWVVVKLRDINDNKPHFERANVEVSVFEDT 1878
             |...|      |||    :..|...|       .:.:.:.:.|: |..|.|...:..:.|:|:.
  Rat   344 TLNIEGANTHLDFRF----SHLGPFKD-------ATMLKIIVGDV-DEPPLFSMPSYVMEVYENA 396

  Fly  1879 KVGTELEKFKATDPDQGGKSKVSYSIDRSSDRQRQFAINQN-GSVTIQRSLDREVVPRHQVKILA 1942
            |:||.:....|.||| ...|.|.|.|:.|::.:|.|.|:.| |::...:.||||..|.:.:.:.|
  Rat   397 KIGTIVGTVLAQDPD-SANSLVRYFINHSTEEERFFNIDANTGTIKTSKVLDREETPWYNITVTA 460

  Fly  1943 IDDGSPPKTATATLTVIVQDINDNAPKFLKDYRPVLPEHVPPRKVVE-ILATDDDDRSKSNGPPF 2006
            .::.:|...:..::.:.|.|:|||.|:..::|..|:.|:..|.:|:. |.|||.||  .:|||.|
  Rat   461 SENDNPDLLSHVSVGIRVLDVNDNPPELAREYDIVVCENSKPGQVIHTITATDKDD--FANGPRF 523

  Fly  2007 QFRLDPSADDIIRASFKVEQDQKGANGDGMA-VISSLRSFDREQQKEYMIPIVIKDHGSPAMTGT 2070
            .|.||....  :..:|.::.     |.|..| :::..|.|.|..|..|.:||:|.|.|.|:::.:
  Rat   524 NFFLDERLP--MNPNFTLKD-----NEDNTASILTRRRRFSRTMQDVYYLPIMISDGGIPSLSSS 581

  Fly  2071 STLTV 2075
            ||||:
  Rat   582 STLTI 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637 27/110 (25%)
Cadherin_repeat 1638..1741 CDD:206637 42/106 (40%)
Cadherin_repeat 1762..1861 CDD:206637 23/121 (19%)
Cadherin_repeat 1871..1966 CDD:206637 29/95 (31%)
Cadherin_repeat 1974..2083 CDD:206637 37/104 (36%)
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
Cdh18NP_001101126.2 CA 79..157 CDD:214520 28/105 (27%)
Cadherin_repeat 163..264 CDD:206637 43/107 (40%)
Cadherin_repeat 272..379 CDD:206637 26/135 (19%)
Cadherin_repeat 387..484 CDD:206637 29/97 (30%)
Cadherin_repeat 491..589 CDD:206637 37/105 (35%)
Cadherin_C 637..783 CDD:395833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5067
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.