DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and Agrn

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:XP_017448655.1 Gene:Agrn / 25592 RGDID:2067 Length:2066 Species:Rattus norvegicus


Alignment Length:850 Identity:180/850 - (21%)
Similarity:299/850 - (35%) Gaps:230/850 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  2190 GSVRLSGISDEDFIRVWNYRTQSMSRSKMDRF-------RDKLADLLNTERENVDIFSVQLKRKH 2247
            |.:.|.|:..::.     :.|..|:..|.:.|       ...|.||........|.:||:|:...
  Rat  1136 GVLELEGVEGQEL-----FYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFWSVRLRELG 1195

  Fly  2248 P-----PLTDVRFSAHGSPYYKPVRLNGIVLMHREEIEKDVGINI-------------------- 2287
            |     .:.||.|....:.....|   |..|:.:.::.:...:.:                    
  Rat  1196 PGKLVRAIVDVHFDPTTAFQASDV---GQALLRQIQVSRPWALAVRRPLQEHVRFLDFDWFPTFF 1257

  Fly  2288 --TMVGIDECLYENQMCEGSCTNSLEISPLPYMVNANKTALVGVRVDTIADCTCGARNFTKP--- 2347
              ...|....:...:....|...:..::|..|..:.::.........|.......|.|..:|   
  Rat  1258 TGAATGTTAAMATARATTVSRLPASSVTPRVYPSHTSRPVGRTTAPPTTRRPPTTATNMDRPRTP 1322

  Fly  2348 ------ESCRTTPCHNGGRCVDTRFGP--HCSCPVGYTGPRCQQ----TTRSFRGNGWAWYPPLE 2400
                  :||.:.||.:||.|.|...|.  .|||..|..|..|::    :..:|:|:.:..:|.|.
  Rat  1323 GHQQPSKSCDSQPCLHGGTCQDQDSGKGFTCSCTAGRGGSVCEKVQPPSMPAFKGHSFLAFPTLR 1387

  Fly  2401 MCDESHLSLEFITRKPDGLIIYNGPIVPPERDETLISDFIALELERGYPRLLIDFGSGTLELRVK 2465
            ......|:|||...:.:||::|||        .....||:||.|..|..:...|.|||...|  .
  Rat  1388 AYHTLRLALEFRALETEGLLLYNG--------NARGKDFLALALLDGRVQFRFDTGSGPAVL--T 1442

  Fly  2466 TKKTLDDGEWHRIDL--FWDTESIRMVVDFCKSAEIAEMEDGTPPEFDDMSCQARGQIPPFNEYL 2528
            :...::.|.|||::|  .|...::.:              ||..|        ..|:.|...:.|
  Rat  1443 SLVPVEPGRWHRLELSRHWRQGTLSV--------------DGETP--------VVGESPSGTDGL 1485

  Fly  2529 NVNAPLQVGGLYREQFDQSLYFWHYMPTAKGFDGCIRNLVHNSKLYDLA---------------- 2577
            |::..|.|||:..||....|   .......|..||||.|..|::..:|:                
  Rat  1486 NLDTNLYVGGIPEEQVAMVL---DRTSVGVGLKGCIRMLDINNQQLELSDWQRAAVQSSGVGECG 1547

  Fly  2578 -HPGLSRNSVAG--------------CP--QTEEVCAQTETTAR---CWEHGNC-VGSLSEARCH 2621
             ||.|......|              ||  :....||..::..:   |.....| |.|...|:|.
  Rat  1548 DHPCLPNPCHGGALCQALEAGMFLCQCPPGRFGPTCADEKSPCQPNPCHGAAPCRVLSSGGAKCE 1612

  Fly  2622 CRPGWTGPACNIPTIPTT---------FKAQSY--VKYALSFEPDRFSTQ-VQLRFRTREEYGEL 2674
            |..|.:|..|.  |:..|         |...||  :|...:||.|..... :::.|..|...|.|
  Rat  1613 CPLGRSGTFCQ--TVLETAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLL 1675

  Fly  2675 FRVSDQHN--REYGILEIKDGHLHFRYNLNS----LRTEEKDLWLNAIVVNDGQWHVVKVNRYGS 2733
            .....:.:  .::..|.:.:.||.|.|:|..    :|::|.        :..|.|..|.:.|.|.
  Rat  1676 LYNGQKTDGKGDFVSLALHNRHLEFCYDLGKGAAVIRSKEP--------IALGTWVRVFLERNGR 1732

  Fly  2734 AATLEL-DG----GEGRRYNETFEFVGHQWLLVDKQEGVYAGGKAEYTGVRTFEVYADYQKSCLD 2793
            ...|:: ||    ||..:..:    |.|  .:::.:|.:|.||..:::.:......:......:.
  Rat  1733 KGALQVGDGPRVLGESPKSRK----VPH--TMLNLKEPLYIGGAPDFSKLARGAAVSSGFNGVIQ 1791

  Fly  2794 DIRLEGKHLPLPPAMNGTQWGQATMARNLEKGCPSNKPCSNVICPDPFECVDLWNVYECTCGEGR 2858
            .:.|.|..|          ..|..:.|.::....::.||:                         
  Rat  1792 LVSLRGHQL----------LTQEHVLRAVDVSPFADHPCT------------------------- 1821

  Fly  2859 IMSPDSKGCMDRNECLDMPCMNGATCINLEPR-LRYRCICPDGFWGENCE--LVQEGQTLKLSMG 2920
                         :.|..||:||.:|:   || ..|.|:||.||.|.:||  ||::      |:|
  Rat  1822 -------------QALGNPCLNGGSCV---PREATYECLCPGGFSGLHCEKGLVEK------SVG 1864

  Fly  2921 ALAAI 2925
            .|..:
  Rat  1865 DLETL 1869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637
Cadherin_repeat 1638..1741 CDD:206637
Cadherin_repeat 1762..1861 CDD:206637
Cadherin_repeat 1871..1966 CDD:206637
Cadherin_repeat 1974..2083 CDD:206637
EGF 2350..2380 CDD:278437 13/31 (42%)
LamG 2385..2570 CDD:238058 50/186 (27%)
EGF_2 <2605..2631 CDD:285248 9/26 (35%)
Laminin_G_2 2665..2800 CDD:280389 29/145 (20%)
EGF_CA 2869..2907 CDD:238011 15/38 (39%)
Cadherin_C 2952..3088 CDD:279398
AgrnXP_017448655.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.