DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CadN and Cdh24

DIOPT Version :9

Sequence 1:NP_001027277.1 Gene:CadN / 35070 FlyBaseID:FBgn0015609 Length:3101 Species:Drosophila melanogaster
Sequence 2:NP_955764.1 Gene:Cdh24 / 239096 MGIID:1928330 Length:781 Species:Mus musculus


Alignment Length:562 Identity:163/562 - (29%)
Similarity:275/562 - (48%) Gaps:65/562 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1536 PKRVLQVTATDGDKDRPQ-NIVYFLTGQGIDPDNPANSKFDINRTTGEIFVLKPLDRDQPNGRPQ 1599
            |:.|| :.....|.||.: ...|.|||:|      |.:.|.|:..||.|.|.|.|||::   :.|
Mouse    60 PEPVL-IGKLHSDVDRGEGRTKYLLTGEG------AGTVFVIDEATGNIHVTKSLDREE---KAQ 114

  Fly  1600 WRFTVFAQDE-GGEGLVGYADVQVNLKDINDNAPIFPQGVYFGNVTENGTAGMVVMTMTAVDYDD 1663
            :.....|.|. ....|...::..:.::|||||.|:||.|.|...|.|....|..|:.:||.|.||
Mouse   115 YVLLAQAVDRASNRPLEPPSEFIIKVQDINDNPPVFPLGPYHATVPEMSNVGTSVIQVTAHDADD 179

  Fly  1664 PNEGSNARLVYSIEKNVIEEETGSPIFEIEPDTGVIKTAVCCLDRERTPDYSIQVVAMD----GG 1724
            |:.|::|:|||::       ..|.|.|.::|.|||::||:..:|||...::.:.:.|.|    .|
Mouse   180 PSYGNSAKLVYTV-------LDGLPFFSVDPQTGVVRTAIPNMDRETQEEFLVVIQAKDMGGHMG 237

  Fly  1725 GLKGTGTASIRVKDINDMPPQFTKDEWFTEVDETDGTALPEMPILTVTVHDED--ETNKFQYKVI 1787
            ||.|:.|.::.:.|:||.||:|.:..:...|.||.|   |...:..:...|.|  :.....|.::
Mouse   238 GLSGSTTVTVTLSDVNDNPPKFPQSLYQFSVVETAG---PGTLVGRLKAQDPDLGDNALVAYSIL 299

  Fly  1788 DNSGYGADKFTMVRNNDG-TGSLKIVQPLDYEDQLQSNGFRFRIQVND---------KGEDNDND 1842
              :|.|::.|::..::.| .|.|.:.:|||:|.:   ..:.||::..:         :|...|  
Mouse   300 --NGEGSEVFSISTDSQGQDGLLTVRKPLDFETR---RSYTFRVEATNTLIDPAYLRRGPFKD-- 357

  Fly  1843 KYHVAYSWVVVKLRDINDNKPHFERANVEVSVFEDTKVGTELEKFKATDPDQGGKSKVSYSIDRS 1907
                 .:.|.|.::|..: .|.|.:|...::|.|:...||.:.:..|:|.|... |.:.|||...
Mouse   358 -----VASVRVTVQDAPE-PPAFTQATYHLAVPENKAPGTLVGQISASDLDSPA-SPIRYSILPH 415

  Fly  1908 SDRQRQFAIN-QNGSVTIQRSLDREVVPRHQVKILAIDDGSPPKTATATLTVIVQDINDNAPKFL 1971
            ||.:|.|:|. ::|::.....||||....|.:.|||.:..|..:::...:.:...|.|||||:..
Mouse   416 SDPERCFSIEPEDGTIRTAVRLDREARVWHNLTILATELDSSAQSSRVQVAIQTLDENDNAPQLA 480

  Fly  1972 KDYRPVLPEHVPPRKVVEIL-ATDDDDRSKSNGPPFQFRLDPSADDIIRASFKVEQDQKGANGDG 2035
            :.|...:.:...|.:::::: |.|.|:...|:....|..:.|.|:..:|           .|.||
Mouse   481 EPYDIFVCDSAAPGQLIKVIRALDRDEVGNSSQVSLQGPVGPDANFTVR-----------DNRDG 534

  Fly  2036 MAVISSLRSFDREQQKEYMIPIVIKDHGSPAMTGTSTLTVII 2077
            .|.:.........:|..|:|||.:.|.|.||::.|:|:||.:
Mouse   535 SASLLLPSRPAPPRQAPYLIPIELWDWGQPALSSTATVTVSV 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CadNNP_001027277.1 Cadherin_repeat 178..301 CDD:206637
Cadherin_repeat 337..396 CDD:206637
E_set 449..541 CDD:298831
Cadherin_repeat 549..>625 CDD:206637
Cadherin_repeat 655..752 CDD:206637
Cadherin_repeat 765..853 CDD:206637
Cadherin_repeat 862..964 CDD:206637
Cadherin_repeat 973..1074 CDD:206637
Cadherin_repeat 1083..1166 CDD:206637
Cadherin_repeat <1219..1298 CDD:206637
Cadherin_repeat 1310..1414 CDD:206637
Cadherin_repeat 1423..1514 CDD:206637
Cadherin_repeat 1522..1630 CDD:206637 29/95 (31%)
Cadherin_repeat 1638..1741 CDD:206637 36/106 (34%)
Cadherin_repeat 1762..1861 CDD:206637 21/110 (19%)
Cadherin_repeat 1871..1966 CDD:206637 28/95 (29%)
Cadherin_repeat 1974..2083 CDD:206637 27/105 (26%)
EGF 2350..2380 CDD:278437
LamG 2385..2570 CDD:238058
EGF_2 <2605..2631 CDD:285248
Laminin_G_2 2665..2800 CDD:280389
EGF_CA 2869..2907 CDD:238011
Cadherin_C 2952..3088 CDD:279398
Cdh24NP_955764.1 CA 70..148 CDD:214520 28/86 (33%)
Cadherin_repeat 154..255 CDD:206637 37/107 (35%)
Cadherin_repeat 264..368 CDD:206637 24/118 (20%)
Cadherin_repeat 378..475 CDD:206637 28/97 (29%)
Cadherin 485..577 CDD:356102 26/103 (25%)
Cadherin_C 625..776 CDD:366437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 665..700
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 731..762
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5176
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.